Mouse Ifnk/If1fa ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_199157.2)

Cat. No.: pGMAAV000937
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Ifnk/If1fa Adeno-associated virus expression plasmid (ITR-vector) for Ifnk AAV packaging, Ifnk AAV production.The purified Mouse Ifnk/If1fa AAV particle serves as an invaluable asset for in-depth in vivo Ifnk studies, mechanism of action (MOA) research, and the evolution of Ifnk-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000937
Gene Name Ifnk
Accession Number NM_199157.2
Gene ID 387510
Species Mouse
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 600 bp
Gene Alias If1fa
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTCCAAAGTTTTTATGGCTGGTGGCCCTTGTGGCTCTATACATTCCGCCCATCCAATCTCTGAACTGTGTTTACCTGGATGATAGCATCTTGGAAAATGTGAAACTTCTGGGCAGTACCATGACCGGCTTTCCCTTAAGATGTCTAAAAGATATCACAGATTTTAAGTTTCCTAAAGAGATTTTGCCATACATCCAGCATATGAAAAGGGAGATAAACGCCGTCTCCTATCGTATATCCTCTCTGGCACTAACTATCTTCAATCTTAAAGGCTCCATCCCTCCAGTGACAGAGGAACACTGGGAACGTATCAGATCGGGACTTTTCAAACAAGTGCGGCAAGCTCAAGAGTGCTTCATGGACGAGGAGAAAGAGAACAGGGAACATCCTCACTCCGAGGACTTCCTGACAGTCTACCTGGAGTTGGGCAAGTATTTCTTCAGAATCAAAAAGTTCCTGATAAATAAGAAATACAGTTTCTGTGCATGGAAGATTGTCACAGTGGAAATAAGAAGATGTTTCATTATATTTTCCAAGTCCAGAAAACTACTCAAAATGATATCAGAATCACCCACCTTCAAGCAAGAACTTAAATAG
ORF Protein Sequence MTPKFLWLVALVALYIPPIQSLNCVYLDDSILENVKLLGSTMTGFPLRCLKDITDFKFPKEILPYIQHMKREINAVSYRISSLALTIFNLKGSIPPVTEEHWERIRSGLFKQVRQAQECFMDEEKENREHPHSEDFLTVYLELGKYFFRIKKFLINKKYSFCAWKIVTVEIRRCFIIFSKSRKLLKMISESPTFKQELK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAAV000937 Mouse Ifnk Adeno-associate virus(AAV) particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.