Rat Fcgr2a/Fcgr3/Fcgr3a ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_053843.3)
Cat. No.: pGMAAV001429
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Rat Fcgr2a/Fcgr3/Fcgr3a Adeno-associated virus expression plasmid (ITR-vector) for Fcgr2a AAV packaging, Fcgr2a AAV production.The purified Rat Fcgr2a/Fcgr3/Fcgr3a AAV particle serves as an invaluable asset for in-depth in vivo Fcgr2a studies, mechanism of action (MOA) research, and the evolution of Fcgr2a-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Product Description
Catalog ID | pGMAAV001429 |
Gene Name | Fcgr2a |
Accession Number | NM_053843.3 |
Gene ID | 116591 |
Species | Rat |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 804 bp |
Gene Alias | Fcgr3,Fcgr3a |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTTTGGAGACCCAGATGTTTCAGAATGCACATTCTGGAAGCCAATGGCTACTCCCACCACTGACAATGTTGCTGCTGTTTGCTTTTGCAGACAGGCAGACGGGAGATCTTCTGAAGGCTGTGGTGAAACGTGATCCCCCATGGATCCAGGTGCTCAAGGACGACACTGTGACGCTGACGTGCGAAGGGACCCACAATCCTGGAAACTCTTCTACCCAGTGGTTCCACAACCAGAGCTCCACCTGGGGCCAGGTCCAAGCCAGCTACACGTTTAAGGCCACAGTCAATGACAGTGGAGAATACCGGTGCCGAATGGCGCACACCAGCCTCAGCGACCCCGTACATCTGGAAGTGATTTCTGACTGGCTGCTGCTCCAGACCCCTCAACTGGTGTTTCTGGAAGGAGAAAGAATCACATTGAGGTGTCACGGCTGGAAGAGCATACAGCTGGCCAGGATTTCATTCCTCCAGAATGGAGAATTTGTGTCATTTCATCCTTATAATGTTAGCTACTCCATCTCAAACGCCAACCACAGTCACAGTGGGGACTACTACTGCAAAGCATATCTAGGAAGGACAGAACACGTGTCCAAGCCTGTCACCATCACTGTCCAAGGTTCAGCAACGGCGTCCACCAGCTCTCTAGTGTGGTTCCATGCCGCTTTCTGCCTAGTGATGTGCCTCCTGTTTGCAGTGGACACCGGCCTGTATTTCTGTGTACGGAGAAATCTTCAAACCTCGGGGGAGGACTGGAGGAGATCCCTGTCAGTCGGAAAGTACAAGGCTCCACAGGACAAATGA |
ORF Protein Sequence | MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVISDWLLLQTPQLVFLEGERITLRCHGWKSIQLARISFLQNGEFVSFHPYNVSYSISNANHSHSGDYYCKAYLGRTEHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFCVRRNLQTSGEDWRRSLSVGKYKAPQDK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
ORF Viral Vector | vGMAAV001429 | Rat Fcgr2a Adeno-associate virus(AAV) particle |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.