Mouse Bnip3/Nip3 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_009760.4)

Cat. No.: pGMAAV001770
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Bnip3/Nip3 Adeno-associated virus expression plasmid (ITR-vector) for Bnip3 AAV packaging, Bnip3 AAV production.The purified Mouse Bnip3/Nip3 AAV particle serves as an invaluable asset for in-depth in vivo Bnip3 studies, mechanism of action (MOA) research, and the evolution of Bnip3-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.


Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV001770
Gene Name Bnip3
Accession Number NM_009760.4
Gene ID 12176
Species Mouse
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 564 bp
Gene Alias Nip3
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CTNT
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCAGAGCGGGGAGGAGAACCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATGGCAATGGGAGCAGCGTTCCAGCCTCCGTCTCTATTTATAATGGTGACATGGAAAAAATACTGTTGGATGCCCAGCATGAATCTGGACGAAGTAGCTCCAAGAGTTCTCACTGTGACAGCCCACCTCGCTCCCAGACACCACAAGATACCAACAGAGCTGAAATAGACAGCCACAGCTTTGGCGAGAAAAACAGCACTCTGTCTGAGGAAGATTATATTGAGAGAAGAAGAGAAGTTGAAAGTATCCTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGACCAGAAAATATTCCCCCCAAGGAGTTCCTTTTTAAACACCCGAAGCGCACAGCTACTCTCAGCATGAGAAACACAAGCGTTATGAAGAAAGGGGGAATTTTCTCAGCAGACTTTCTGAAGGTTTTCCTTCCATCTCTGTTACTGTCTCATCTGCTGGCCATTGGCTTGGGGATCTACATTGGAAGGCGTCTGACAACTTCCACTAGCACCTTCTGA
ORF Protein Sequence MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAAV001770 Mouse Bnip3 Adeno-associate virus(AAV) particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.