Mouse Isg15/100038882/G1p2 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_015783)

Cat. No.: pGMAAV002009
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Isg15/100038882/G1p2 Adeno-associated virus expression plasmid (ITR-vector) for Isg15 AAV packaging, Isg15 AAV production.The purified Mouse Isg15/100038882/G1p2 AAV particle serves as an invaluable asset for in-depth in vivo Isg15 studies, mechanism of action (MOA) research, and the evolution of Isg15-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV002009
Gene Name Isg15
Accession Number NM_015783
Gene ID 100038882
Species Mouse
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 486 bp
Gene Alias 100038882,G1p2,IGI15,IP17,Irfp,UCRP
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter GFAP
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTGGGACCTAAAGGTGAAGATGCTGGGGGGTAACGATTTCCTGGTGTCCGTGACTAACTCCATGACGGTGTCAGAACTGAAGAAGCAGATTGCCCAGAAGATTGGTGTGCCGGCTTTCCAGCAGCGCCTGGCCCACCAAACTGCAGTGCTCCAGGACGGTCTTACCCTTTCCAGTCTGGGTCTGGGTCCCAGCAGCACAGTGATGCTAGTGGTACAGAACTGCAGCGAGCCTCTGAGCATCCTGGTGAGGAACGAAAGGGGCCACAGCAACATCTATGAGGTCTTTCTGACGCAGACTGTAGACACGCTTAAGAAGAAGGTGTCCCAGCGGGAACAAGTCCACGAAGACCAGTTCTGGCTGAGCTTCGAGGGAAGGCCCATGGAGGACAAGGAGCTGCTGGGGGAGTATGGCCTAAAGCCCCAGTGCACAGTGATCAAGCATTTGCGCCTGAGGGGTGGGGGAGGGGACCAGTGTGCCTAA
ORF Protein Sequence MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAAV002009 Mouse Isg15 Adeno-associate virus(AAV) particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.