Mouse Tomm20/1810060K07Rik/BB284719 ORF/cDNA clone-Adenovirus plasmid (NM_024214.2)

Cat. No.: pGMAD000623
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Tomm20/1810060K07Rik/BB284719 adenoviral expression plasmid for Tomm20 adenovirus packaging, Tomm20 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000623
Gene Name Tomm20
Accession Number NM_024214.2
Gene ID 67952
Species Mouse
Product Type Adenovirus plasmid (overexpression)
Insert Length 438 bp
Gene Alias 1810060K07Rik,BB284719,Gm19268,MAS20,mKIAA0016,MOM19,TOM20
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGGCCGGAACAGCGCCATCGCCGCGGGCGTGTGCGGTGCCCTCTTCATCGGGTACTGCATCTACTTCGACCGCAAAAGGCGGAGTGACCCCAACTTCAAGAACAGGCTTCGAGAACGAAGAAAGAAACAGAAGCTTGCTAAGGAGAGAGCTGGGCTTTCCAAGTTACCTGATTTAAAAGATGCTGAAGCAGTTCAGAAATTCTTCCTTGAAGAGATACAGCTTGGTGAAGAGTTACTAGCACAAGGTGACTACGAGAAGGGTGTGGACCACCTGACAAATGCCATTGCTGTGTGTGGACAGCCTCAGCAGCTGCTGCAAGTGTTACAGCAGACTCTTCCGCCACCAGTGTTCCAGATGCTTCTGACCAAGCTTCCGACCATTAGTCAGAGAATTGTAAGTGCTCAGAGCTTGGCTGAAGATGATGTGGAATGA
ORF Protein Sequence MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAD000623 Mouse Tomm20 Adenovirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.