Rat Rap2c ORF/cDNA clone-Adenovirus plasmid (NM_001106950)

Cat. No.: pGMAD001032
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Rat Rap2c/ adenoviral expression plasmid for Rap2c adenovirus packaging, Rap2c adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001032
Gene Name Rap2c
Accession Number NM_001106950
Gene ID 302495
Species Rat
Product Type Adenovirus plasmid (overexpression)
Insert Length 552 bp
Gene Alias
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGGGAATACAAGGTAGTGGTGTTAGGGAGCGGAGGGGTTGGCAAATCTGCCCTCACTGTGCAGTTTGTCACCGGGACTTTCATTGAGAAATATGACCCCACCATTGAAGATTTCTACCGCAAAGAGATCGAAGTGGACTCTTCTCCGTCAGTACTGGAAATTCTGGACACCGCGGGAACAGAGCAGTTTGCCTCCATGAGAGATCTGTACATCAAAAACGGCCAAGGTTTCATCCTGGTGTATAGTTTGGTTAATCAACAGTCTTTTCAGGATATCAAGCCAATGAGAGATCAGATTGTGAGAGTGAAGAGATACGAGAAAGTTCCACTAATCCTAGTAGGAAACAAAGTGGATCTGGAACCAGAAAGAGAGGTTATGTCTTCTGAAGGCAGAGCTCTGGCTCAAGAATGGGGCTGTCCTTTCATGGAAACATCAGCAAAAAGTAAATCAATGGTGGATGAACTTTTTGCTGAGATCGTCAGGCAAATGAACTATTCATCCCTACCCGAGAAGCAAGATCAGTGTTGTACAACTTGTGTTGTCCAGTAA
ORF Protein Sequence MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAD001032 Rat Rap2c Adenovirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.