Mouse Rpl35/2410039E09Rik ORF/cDNA clone-Adenovirus plasmid (NM_025592.3)

Cat. No.: pGMAD001037
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Rpl35/2410039E09Rik adenoviral expression plasmid for Rpl35 adenovirus packaging, Rpl35 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001037
Gene Name Rpl35
Accession Number NM_025592.3
Gene ID 66489
Species Mouse
Product Type Adenovirus plasmid (overexpression)
Insert Length 372 bp
Gene Alias 2410039E09Rik
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCCAAGATTAAGGCTCGGGACCTGCGCGGCAAGAAGAAGGAGGAGCTGTTGAAACAACTGGACGATCTGAAGGTGGAATTGTCCCAGCTTCGGGTCGCCAAAGTGACAGGCGGCGCCGCGTCCAAGCTCTCCAAGATACGAGTCGTTCGCAAGTCTATCGCCCGAGTCCTCACTGTTATTAACCAGACTCAAAAAGAAAACCTCAGGAAATTCTACAAGGGCAAGAAATACAAGCCCCTAGACCTGCGACCCAAGAAGACTAGAGCCATGCGCCGCCGGCTCACCAAGCACGAGGAGAAGCTGAAGACCAAGAAGCAGCAGCGGAAGGAGCGGCTGTATCCTCTGCGCAAGTATGCAGTCAAGGCCTGA
ORF Protein Sequence MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKTKKQQRKERLYPLRKYAVKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAD001037 Mouse Rpl35 Adenovirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.