Human CUEDC2/bA18I14.5/C10orf66 ORF/cDNA clone-Lentivirus plasmid (NM_024040)

Cat. No.: pGMLP001266
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CUEDC2/bA18I14.5/C10orf66 Lentiviral expression plasmid for CUEDC2 lentivirus packaging, CUEDC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Total Price: $516
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001266
Gene Name CUEDC2
Accession Number NM_024040
Gene ID 79004
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 864 bp
Gene Alias bA18I14.5,C10orf66
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCTGGAGAGGATCGTCAGTGCAGCCCTCCTTGCCTTTGTCCAGACACACCTCCCGGAGGCCGACCTCAGTGGCTTGGATGAGGTCATCTTCTCCTATGTGCTTGGGGTCCTGGAGGACCTGGGCCCCTCGGGCCCATCAGAGGAGAACTTCGATATGGAGGCTTTCACTGAGATGATGGAGGCCTATGTGCCTGGCTTCGCCCACATCCCCAGGGGCACAATAGGGGACATGATGCAGAAGCTCTCAGGGCAGCTGAGCGATGCCAGGAACAAAGAGAACCTGCAACCGCAGAGCTCTGGTGTCCAAGGTCAGGTGCCCATCTCCCCAGAGCCCCTGCAGCGGCCCGAAATGCTCAAAGAAGAGACTAGGTCTTCGGCTGCTGCTGCTGCAGACACCCAAGATGAGGCAACTGGCGCTGAGGAGGAGCTTCTGCCAGGGGTGGATGTACTCCTGGAGGTGTTCCCTACCTGTTCGGTGGAGCAGGCCCAGTGGGTGCTGGCCAAAGCTCGGGGGGACTTGGAAGAAGCTGTGCAGATGCTGGTAGAGGGAAAGGAAGAGGGGCCTGCAGCCTGGGAGGGCCCCAACCAGGACCTGCCCAGACGCCTCAGAGGCCCCCAAAAGGATGAGCTGAAGTCCTTCATCCTGCAGAAGTACATGATGGTGGATAGCGCAGAGGATCAGAAGATTCACCGGCCCATGGCTCCCAAGGAGGCCCCCAAGAAGCTGATCCGATACATCGACAACCAGGTAGTGAGCACCAAAGGGGAGCGATTCAAAGATGTGCGGAACCCTGAGGCCGAGGAGATGAAGGCCACATACATCAACCTCAAGCCAGCCAGAAAGTACCGCTTCCATTGA
ORF Protein Sequence MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMLP001266 Human CUEDC2 Lentivirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.