Mouse Pdpn/E11/Gp38 ORF/cDNA clone-Lentivirus plasmid (NM_010329.3)
Cat. No.: pGMLPm001042
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Mouse Pdpn/E11/Gp38 Lentiviral expression plasmid for Pdpn lentivirus packaging, Pdpn lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Product Description
Catalog ID | pGMLPm001042 |
Gene Name | Pdpn |
Accession Number | NM_010329.3 |
Gene ID | 14726 |
Species | Mouse |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 519 bp |
Gene Alias | E11,Gp38,OTS-8,RANDAM-2,T1-alpha,T1a,T1alpha |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTGGACCGTGCCAGTGTTGTTCTGGGTTTTGGGGAGCGTTTGGTTCTGGGACTCTGCGCAGGGAGGGACTATAGGCGTGAATGAAGATGATATTGTGACCCCAGGTACAGGAGACGGCATGGTGCCCCCAGGTATAGAAGACAAAATAACAACCACAGGTGCTACTGGAGGGCTTAATGAATCTACTGGCAAGGCACCTCTGGTACCAACGCAGAGAGAGCGTGGGACGAAGCCTCCCTTAGAGGAACTGTCCACCTCAGCAACCTCAGACCATGATCACAGAGAACACGAGAGTACAACCACTGTCAAAGTGGTGACTAGCCACTCTGTGGACAAGAAAACAAGTCACCCCAATAGAGATAATGCAGGGGATGAAACGCAGACAACAGATAAGAAAGATGGCTTGCCAGTAGTCACCCTGGTTGGAATCATAGTTGGCGTCTTGTTAGCCATTGGCTTCGTCGGAGGGATCTTCATTGTTGTTATGAAGAAGATTTCTGGAAGGTTCTCGCCCTAA |
ORF Protein Sequence | MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
ORF Viral Vector | vGMLPm001042 | Mouse Pdpn Lentivirus particle |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.