Mouse Rhoa/Arha/Arha1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_016802.5)

Cat. No.: pGMPC000009
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Rhoa/Arha/Arha1 Non-Viral expression plasmid (overexpression vector) for mouse Rhoa overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000009
Gene Name Rhoa
Accession Number NM_016802.5
Gene ID 11848
Species Mouse
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 582 bp
Gene Alias Arha,Arha1,Arha2
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCATCAGGAAGAAACTGGTGATTGTTGGTGATGGAGCTTGTGGTAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTCTATGTGCCCACGGTGTTTGAAAACTATGTGGCGGATATCGAGGTGGATGGGAAGCAGGTAGAGTTGGCTTTATGGGACACAGCTGGACAGGAAGATTATGACCGCCTGCGGCCTCTCTCTTATCCAGACACCGATGTTATATTGATGTGTTTTTCCATTGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAATGGACTCCAGAAGTCAAGCATTTCTGTCCAAATGTGCCCATCATCCTGGTTGGGAACAAGAAGGACCTTCGGAATGACGAGCACACGAGACGGGAGTTGGCCAAAATGAAGCAGGAGCCGGTAAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAGATGGCCACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAGTCTGGGTGCCTCATCTTGTGA
ORF Protein Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL

Reference




    Data / case study


    Click to get more Data / Case study about the product.







    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.