Human LCE1C/LEP3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_178351.4)
Cat. No.: pGMPC000267
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LCE1C/LEP3 Non-Viral expression plasmid (overexpression vector) for mouse LCE1C overexpression in unique cell transient transfection and stable cell line development.
Product Description
Catalog ID | pGMPC000267 |
Gene Name | LCE1C |
Accession Number | NM_178351.4 |
Gene ID | 353133 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 357 bp |
Gene Alias | LEP3 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | HA (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCCTGCCAGCAGAGCCAGCAGCAGTGCCAGCCCCCTCCCAAGTGCACCCCCAAGTGCCCTCCCAAGTGCCCCACCCCAAAGTGTCCCCCAAAGTGTCCCCCTAAGTGCCCTCCTGTCTCTTCCTGCTGCAGTGTCAGCTCCGGAGGCTGCTGTGGCTCCAGCTCTGGGGGCAGCTGTGGCTCCAGCTCTGGGGGATGCTGCAGTTCTGGGGGAGGTGGCTGCTGCCTGAGCCACCACAGGCGCCGTAGGTCCCACTGCCACAGACCCCAGAGCTCTGGCTGCTGCAGCCAGCCCTCGGGGGGCTCCAGCTGCTGTGGCGGGGGGAGTGGCCAGCACTCTGGAGGCTGCTGCTGA |
ORF Protein Sequence | MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC |
Reference
Data / case study
Click to get more Data / Case study about the product.
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.