Mouse H2bc21/AV127319/H2b-613 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_178214.4)

Cat. No.: pGMPC000538
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse H2bc21/AV127319/H2b-613 Non-Viral expression plasmid (overexpression vector) for mouse H2bc21 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000538
Gene Name H2bc21
Accession Number NM_178214.4
Gene ID 319190
Species Mouse
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 381 bp
Gene Alias AV127319,H2b-613,Hist2h2,Hist2h2be,T25626
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGAACTGGCCAAATCTGCCCCGGCTCCCAAGAAGGGTTCCAAGAAGGCTGTCACCAAGGCGCAAAAGAAAGATGGCAAGAAGCGCAAGCGCAGCCGCAAGGAGAGCTACTCCATCTATGTGTACAAAGTGCTGAAGCAGGTGCACCCGGACACCGGCATCTCGTCCAAGGCCATGGGCATCATGAACTCGTTTGTCAATGACATCTTTGAGCGCATAGCAAACGAGGCTTCTCGCCTGGCGCATTACAACAAGCGGTCTACAATCACATCGCGGGAGATCCAGACGTCGGTGCGCCTTCTACTGCCCGGAGAACTGGCCAAGCACGCCGTGTCGGAGGGCACCAAGGCCGTCACCAAGTACACCAGCGCCAAGTAG
ORF Protein Sequence MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTSVRLLLPGELAKHAVSEGTKAVTKYTSAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.







    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.