Mouse Ctxnd1/100039239/C77713 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001384188.1)

Cat. No.: pGMPC001030
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Ctxnd1/100039239/C77713 Non-Viral expression plasmid (overexpression vector) for mouse Ctxnd1 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001030
Gene Name Ctxnd1
Accession Number NM_001384188.1
Gene ID 100039239
Species Mouse
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 180 bp
Gene Alias 100039239,C77713,Gm2115
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAACCTACTCCCGAGCCCGTCTATGTGGATGTGGACAAGGGGTTGACCTTGGCTTGCTTCGTTTTCCTTTGCCTCTTCCTCGTAGTCATGATCATCCGCTGTGCCAAAGTCATCATGGACCCCTACAGTGCCATCCCCACGTCCACCTGGGAGGAGCAGCACCTGGATGACTGA
ORF Protein Sequence MEEPTPEPVYVDVDKGLTLACFVFLCLFLVVMIIRCAKVIMDPYSAIPTSTWEEQHLDD

Reference




    Data / case study


    Click to get more Data / Case study about the product.







    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.