Rat Sln ORF/cDNA clone-Adenovirus particle (NM_001013247.1)

Cat. No.: vGMAD001440

Pre-made Rat Sln/ Adenovirus for Sln overexpression in-vitro and in-vivo. The Sln adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified Sln-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD001440 Rat Sln Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD001440
Gene Name Sln
Accession Number NM_001013247.1
Gene ID 367086
Species Rat
Product Type Adenovirus particle (overexpression)
Insert Length 96 bp
Gene Alias
Fluorescent Reporter mCherry
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGCGGTCTACCCAGGAGCTGTTTATCAACTTCACAGTTGTCCTGATCACTGTGCTCCTCATGTGGCTCCTCGTGAGGTCCTACCAATACTGA
ORF Protein Sequence MERSTQELFINFTVVLITVLLMWLLVRSYQY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector pGMAD001440 Rat Sln Adenovirus plasmid




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.