Human EMC10/C19orf63/HSM1 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_175063.6)

Cat. No.: pGMAAV000886
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMC10/C19orf63/HSM1 Adeno-associated virus expression plasmid (ITR-vector) for EMC10 AAV packaging, EMC10 AAV production.The purified Human EMC10/C19orf63/HSM1 AAV particle serves as an invaluable asset for in-depth in vivo EMC10 studies, mechanism of action (MOA) research, and the evolution of EMC10-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EMC10/C19orf63 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000886
Gene Name EMC10
Accession Number NM_175063.6
Gene ID 284361
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 765 bp
Gene Alias C19orf63,HSM1,HSS1,NEDDFAS
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCAGCCAGCGCTGGGGCAACCCGGCTGCTCCTGCTCTTGCTGATGGCGGTAGCAGCGCCCAGTCGAGCCCGGGGCAGCGGCTGCCGGGCCGGGACTGGTGCGCGAGGGGCTGGGGCGGAAGGTCGAGAGGGCGAGGCCTGTGGCACGGTGGGGCTGCTGCTGGAGCACTCATTTGAGATCGATGACAGTGCCAACTTCCGGAAGCGGGGCTCACTGCTCTGGAACCAGCAGGATGGTACCTTGTCCCTGTCACAGCGGCAGCTCAGCGAGGAGGAGCGGGGCCGACTCCGGGATGTGGCAGCCCTGAATGGCCTGTACCGGGTCCGGATCCCAAGGCGACCCGGGGCCCTGGATGGCCTGGAAGCTGGTGGCTATGTCTCCTCCTTTGTCCCTGCGTGCTCCCTGGTGGAGTCGCACCTGTCGGACCAGCTGACCCTGCACGTGGATGTGGCCGGCAACGTGGTGGGCGTGTCGGTGGTGACGCACCCCGGGGGCTGCCGGGGCCATGAGGTGGAGGACGTGGACCTGGAGCTGTTCAACACCTCGGTGCAGCTGCAGCCGCCCACCACAGCCCCAGGCCCTGAGACGGCGGCCTTCATTGAGCGCCTGGAGATGGAACAGGCCCAGAAGGCCAAGAACCCCCAGGAGCAGAAGTCCTTCTTCGCCAAATACTGGCACATCATCCTGGGGGGGGCCGTGTTGCTCACAGCCCTGCGTCCTGCTGCGCCAGGGCCCGCGCCACCGCCACAGGAGGCCTGA
ORF Protein Sequence MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0173-Ab Anti-EMC10/ C19orf63/ HSM1 functional antibody
    Target Antigen GM-Tg-g-SE0173-Ag EMC10 protein
    ORF Viral Vector pGMAAV000886 Human EMC10 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000886 Human EMC10 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0173
    Target Name EMC10
    Gene ID 284361, 69683, 719285, 292878, 101085509, 484362, 507692, 100062997
    Gene Symbol and Synonyms 2310044H10Rik,5430410O10Rik,C18H19orf63,C19H19orf63,C19orf63,C1H19orf63,EMC10,HSM1,HSS1,Inm02,Mirta22,NEDDFAS
    Uniprot Accession Q5UCC4
    Uniprot Entry Name EMC10_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000161671
    Target Classification Not Available

    Contributes to membrane insertase activity. Involved in positive regulation of angiogenesis; positive regulation of endothelial cell proliferation; and protein insertion into ER membrane. Located in extracellular region. Is integral component of endoplasmic reticulum membrane. Part of EMC complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.