Human TMEM215 ORF/cDNA clone-Adenovirus plasmid (NM_212558.2)

Cat. No.: pGMAD000723
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM215/ adenoviral expression plasmid for TMEM215 adenovirus packaging, TMEM215 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to TMEM215/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000723
Gene Name TMEM215
Accession Number NM_212558.2
Gene ID 401498
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 708 bp
Gene Alias
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGCGGCCTGATGACATTAACCCGAGGACTGGGCTGGTGGTGGCCCTGGTCAGTGTCTTCCTCGTCTTTGGTTTCATGTTCACCGTCTCTGGGATGAAAGGGGAGACTTTGGGAAACATCCCCCTCCTGGCCATCGGGCCAGCCATCTGCCTACCAGGCATCGCAGCCATTGCCCTGGCCAGGAAAACCGAGGGATGCACCAAGTGGCCAGAGAACGAGCTGCTGTGGGTCCGCAAATTGCCCTGCTTCCGGAAACCCAAAGACAAGGAGGTGGTAGAGCTGCTGAGGACCCCTTCAGACCTAGAATCCGGCAAGGGGAGCTCAGATGAGCTGGCTAAGAAGGCGGGCCTCAGGGGGAAGCCTCCCCCACAAAGCCAGGGTGAGGTGTCCGTGGCCAGCTCCATCAACAGCCCCACACCCACGGAGGAAGGAGAATGCCAGAGCCTCGTCCAGAATGGGCATCAGGAGGAGACGTCCAGATACCTGGACGGCTACTGCCCCTCGGGCAGTTCCCTCACCTACAGTGCCTTGGACGTCAAGTGCTCAGCAAGGGACAGATCTGAGTGCCCTGAGCCTGAGGATAGCATCTTCTTTGTGCCCCAGGACAGTATCATCGTTTGCTCCTACAAGCAGAACAGCCCGTATGACAGATACTGTTGTTATATCAATCAGATACAAGGCAGGTGGGACCACGAGACCATCGTCTAA
ORF Protein Sequence MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2049-Ab Anti-TMEM215 monoclonal antibody
    Target Antigen GM-Tg-g-IP2049-Ag TMEM215 protein
    ORF Viral Vector pGMLP003472 Human TMEM215 Lentivirus plasmid
    ORF Viral Vector pGMAD000411 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector pGMAD000723 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector vGMLP003472 Human TMEM215 Lentivirus particle
    ORF Viral Vector vGMAD000411 Human TMEM215 Adenovirus particle
    ORF Viral Vector vGMAD000723 Human TMEM215 Adenovirus particle


    Target information

    Target ID GM-IP2049
    Target Name TMEM215
    Gene ID 401498, 320500, 704427, 690918, 101097185, 611763, 510133, 100053699
    Gene Symbol and Synonyms A930001M12Rik,TMEM215
    Uniprot Accession Q68D42
    Uniprot Entry Name TM215_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000188133
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.