Human IL17B/IL-17B/IL-20 ORF/cDNA clone-Lentivirus plasmid (NM_014443)
Cat. No.: pGMLP-IL-021
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL17B/IL-17B/IL-20 Lentiviral expression plasmid for IL17B lentivirus packaging, IL17B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL17B/IL-17B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP-IL-021 |
Gene Name | IL17B |
Accession Number | NM_014443 |
Gene ID | 27190 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 543 bp |
Gene Alias | IL-17B,IL-20,NIRF,ZCYTO7 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACTGGCCTCACAACCTGCTGTTTCTTCTTACCATTTCCATCTTCCTGGGGCTGGGCCAGCCCAGGAGCCCCAAAAGCAAGAGGAAGGGGCAAGGGCGGCCTGGGCCCCTGGCCCCTGGCCCTCACCAGGTGCCACTGGACCTGGTGTCACGGATGAAACCGTATGCCCGCATGGAGGAGTATGAGAGGAACATCGAGGAGATGGTGGCCCAGCTGAGGAACAGCTCAGAGCTGGCCCAGAGAAAGTGTGAGGTCAACTTGCAGCTGTGGATGTCCAACAAGAGGAGCCTGTCTCCCTGGGGCTACAGCATCAACCACGACCCCAGCCGTATCCCCGTGGACCTGCCGGAGGCACGGTGCCTGTGTCTGGGCTGTGTGAACCCCTTCACCATGCAGGAGGACCGCAGCATGGTGAGCGTGCCGGTGTTCAGCCAGGTTCCTGTGCGCCGCCGCCTCTGCCCGCCACCGCCCCGCACAGGGCCTTGCCGCCAGCGCGCAGTCATGGAGACCATCGCTGTGGGCTGCACCTGCATCTTCTGA |
ORF Protein Sequence | MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IO076-Ab | Anti-IL17B/ IL-17B/ IL-20 functional antibody |
Target Antigen | GM-Tg-g-IO076-Ag | IL17B protein |
Cytokine | cks-Tg-g-GM-IO076 | interleukin 17B (IL17B) protein & antibody |
ORF Viral Vector | pGMLP-IL-021 | Human IL17B Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-104 | Human IL17B Adenovirus plasmid |
ORF Viral Vector | vGMLP-IL-021 | Human IL17B Lentivirus particle |
ORF Viral Vector | vGMAP-IL-104 | Human IL17B Adenovirus particle |
Target information
Target ID | GM-IO076 |
Target Name | IL17B |
Gene ID | 27190, 56069, 710679, 116472, 101086204, 489193, 504992, 100060593 |
Gene Symbol and Synonyms | 1110006O16Rik,1700006N07Rik,IL-17B,IL-20,IL17B,NIRF,ZCYTO7 |
Uniprot Accession | Q9UHF5 |
Uniprot Entry Name | IL17B_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
Disease | Lung Cancer |
Gene Ensembl | ENSG00000127743 |
Target Classification | Checkpoint-Immuno Oncology |
The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. Alternative splicing results in multiple splice variants. [provided by RefSeq, Dec 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.