Human IFI30/GILT/IFI-30 ORF/cDNA clone-Lentivirus plasmid (NM_006332)
Cat. No.: pGMLP000039
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IFI30/GILT/IFI-30 Lentiviral expression plasmid for IFI30 lentivirus packaging, IFI30 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IFI30/GILT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000039 |
Gene Name | IFI30 |
Accession Number | NM_006332 |
Gene ID | 10437 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 753 bp |
Gene Alias | GILT,IFI-30,IP-30,IP30 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACCCTGTCGCCACTTCTGCTGTTCCTGCCACCGCTGCTGCTGCTGCTGGACGTCCCCACGGCGGCGGTGCAGGCGTCCCCTCTGCAAGCGTTAGACTTCTTTGGGAATGGGCCACCAGTTAACTACAAGACAGGCAATCTATACCTGCGGGGGCCCCTGAAGAAGTCCAATGCACCGCTTGTCAATGTGACCCTCTACTATGAAGCACTGTGCGGTGGCTGCCGAGCCTTCCTGATCCGGGAGCTCTTCCCAACATGGCTGTTGGTCATGGAGATCCTCAATGTCACGCTGGTGCCCTACGGAAACGCACAGGAACAAAATGTCAGTGGCAGGTGGGAGTTCAAGTGCCAGCATGGAGAAGAGGAGTGCAAATTCAACAAGGTGGAGGCCTGCGTGTTGGATGAACTTGACATGGAGCTAGCCTTCCTGACCATTGTCTGCATGGAAGAGTTTGAGGACATGGAGAGAAGTCTGCCACTATGCCTGCAGCTCTACGCCCCAGGGCTGTCGCCAGACACTATCATGGAGTGTGCAATGGGGGACCGCGGCATGCAGCTCATGCACGCCAACGCCCAGCGGACAGATGCTCTCCAGCCACCACACGAGTATGTGCCCTGGGTCACCGTCAATGGGAAACCCTTGGAAGATCAGACCCAGCTCCTTACCCTTGTCTGCCAGTTGTACCAGGGCAAGAAGCCGGATGTCTGCCCTTCCTCAACCAGCTCCCTCAGGAGTGTTTGCTTCAAGTGA |
ORF Protein Sequence | MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0276-Ab | Anti-GILT/ IFI30/ IFI-30 functional antibody |
Target Antigen | GM-Tg-g-SE0276-Ag | IFI30 protein |
ORF Viral Vector | pGMLP000039 | Human IFI30 Lentivirus plasmid |
ORF Viral Vector | vGMLP000039 | Human IFI30 Lentivirus particle |
Target information
Target ID | GM-SE0276 |
Target Name | IFI30 |
Gene ID | 10437, 65972, 719379, 290644, 101093838, 476669, 615930, 100070878 |
Gene Symbol and Synonyms | GILT,IFI-30,IFI30,IP-30,IP30 |
Uniprot Accession | P13284 |
Uniprot Entry Name | GILT_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000216490 |
Target Classification | Not Available |
The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.