Human PTP4A1/HH72/PRL-1 ORF/cDNA clone-Lentivirus plasmid (NM_003463)

Cat. No.: pGMLP000042
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTP4A1/HH72/PRL-1 Lentiviral expression plasmid for PTP4A1 lentivirus packaging, PTP4A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRL-1/PTP4A1/HH72 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $430.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000042
Gene Name PTP4A1
Accession Number NM_003463
Gene ID 7803
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 522 bp
Gene Alias HH72,PRL-1,PRL1,PTP(CAAX1),PTPCAAX1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGAATGAACCGCCCAGCTCCTGTGGAAGTCACATACAAGAACATGAGATTTCTTATTACACACAATCCAACCAATGCGACCTTAAACAAATTTATAGAGGAACTTAAGAAGTATGGAGTTACCACAATAGTAAGAGTATGTGAAGCAACTTATGACACTACTCTTGTGGAGAAAGAAGGTATCCATGTTCTTGATTGGCCTTTTGATGATGGTGCACCACCATCCAACCAGATTGTTGATGACTGGTTAAGTCTTGTGAAAATTAAGTTTCGTGAAGAACCTGGTTGTTGTATTGCTGTTCATTGCGTTGCAGGCCTTGGGAGAGCTCCAGTACTTGTTGCCCTAGCATTAATTGAAGGTGGAATGAAATACGAAGATGCAGTACAATTCATAAGACAAAAGCGGCGTGGAGCTTTTAACAGCAAGCAACTTCTGTATTTGGAGAAGTATCGTCCTAAAATGCGGCTGCGTTTCAAAGATTCCAACGGTCATAGAAACAACTGTTGCATTCAATAA
ORF Protein Sequence MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85328-Ab Anti-PRL-1 monoclonal antibody
    Target Antigen GM-Tg-g-T85328-Ag PRL-1/PTP4A1 protein
    ORF Viral Vector pGMLP000042 Human PTP4A1 Lentivirus plasmid
    ORF Viral Vector vGMLP000042 Human PTP4A1 Lentivirus particle


    Target information

    Target ID GM-T85328
    Target Name PRL-1
    Gene ID 7803, 19243, 716195, 29463, 101081047, 481863, 613326, 100057042
    Gene Symbol and Synonyms C130021B01,HH72,PRL-1,PRL1,PTP(CAAX1),PTP4A1,PTPCAAX1
    Uniprot Accession Q93096
    Uniprot Entry Name TP4A1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000112245
    Target Classification Not Available

    This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.