Human HAMP/HEPC/HFE2B ORF/cDNA clone-Lentivirus plasmid (NM_021175)
Cat. No.: pGMLP000047
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HAMP/HEPC/HFE2B Lentiviral expression plasmid for HAMP lentivirus packaging, HAMP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HAMP/HEPC products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000047 |
Gene Name | HAMP |
Accession Number | NM_021175 |
Gene ID | 57817 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 255 bp |
Gene Alias | HEPC,HFE2B,LEAP1,PLTR |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCACTGAGCTCCCAGATCTGGGCCGCTTGCCTCCTGCTCCTCCTCCTCCTCGCCAGCCTGACCAGTGGCTCTGTTTTCCCACAACAGACGGGACAACTTGCAGAGCTGCAACCCCAGGACAGAGCTGGAGCCAGGGCCAGCTGGATGCCCATGTTCCAGAGGCGAAGGAGGCGAGACACCCACTTCCCCATCTGCATTTTCTGCTGCGGCTGCTGTCATCGATCAAAGTGTGGGATGTGCTGCAAGACGTAG |
ORF Protein Sequence | MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T22995-Ab | Anti-HEPC/ HAMP/ HFE2B functional antibody |
Target Antigen | GM-Tg-g-T22995-Ag | HAMP protein |
ORF Viral Vector | pGMLP000047 | Human HAMP Lentivirus plasmid |
ORF Viral Vector | vGMLP000047 | Human HAMP Lentivirus particle |
Target information
Target ID | GM-T22995 |
Target Name | HAMP |
Gene ID | 57817, 84506, 708397, 84604, 101084332, 492281, 512301, 100050728 |
Gene Symbol and Synonyms | HAMP,Hamp1,HEPC,Hepc1,hepcidin,HFE2B,LEAP1,PLTR |
Uniprot Accession | P81172 |
Uniprot Entry Name | HEPC_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Ovary Cancer |
Gene Ensembl | ENSG00000105697 |
Target Classification | Not Available |
The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.