Human TCL1A/TCL1 ORF/cDNA clone-Lentivirus plasmid (NM_021966)
Cat. No.: pGMLP000066
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TCL1A/TCL1 Lentiviral expression plasmid for TCL1A lentivirus packaging, TCL1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TCL1A/TCL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000066 |
Gene Name | TCL1A |
Accession Number | NM_021966 |
Gene ID | 8115 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 345 bp |
Gene Alias | TCL1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGAGTGCCCGACACTCGGGGAGGCAGTCACCGACCACCCGGACCGCCTGTGGGCCTGGGAGAAGTTCGTGTATTTGGACGAGAAGCAGCACGCCTGGCTGCCCTTAACCATCGAGATAAAGGATAGGTTACAGTTACGGGTGCTCTTGCGTCGGGAAGACGTCGTCCTGGGGAGGCCTATGACCCCCACCCAGATAGGCCCAAGCCTGCTGCCTATCATGTGGCAGCTCTACCCTGATGGACGATACCGATCCTCAGACTCCAGTTTCTGGCGCTTAGTGTACCACATCAAGATTGACGGCGTGGAGGACATGCTTCTCGAGCTGCTGCCAGATGACTGA |
ORF Protein Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T84671-Ab | Anti-TCL1A monoclonal antibody |
Target Antigen | GM-Tg-g-T84671-Ag | TCL1A protein |
ORF Viral Vector | pGMLP000066 | Human TCL1A Lentivirus plasmid |
ORF Viral Vector | vGMLP000066 | Human TCL1A Lentivirus particle |
Target information
Target ID | GM-T84671 |
Target Name | TCL1A |
Gene ID | 8115, 21432, 703349, 101090193, 119872954, 506540, 100630002 |
Gene Symbol and Synonyms | TCL1,TCL1A |
Uniprot Accession | P56279 |
Uniprot Entry Name | TCL1A_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000100721 |
Target Classification | Tumor-associated antigen (TAA) |
Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.