Human TCL1A/TCL1 ORF/cDNA clone-Lentivirus plasmid (NM_021966)

Cat. No.: pGMLP000066
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TCL1A/TCL1 Lentiviral expression plasmid for TCL1A lentivirus packaging, TCL1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TCL1A/TCL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000066
Gene Name TCL1A
Accession Number NM_021966
Gene ID 8115
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 345 bp
Gene Alias TCL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGTGCCCGACACTCGGGGAGGCAGTCACCGACCACCCGGACCGCCTGTGGGCCTGGGAGAAGTTCGTGTATTTGGACGAGAAGCAGCACGCCTGGCTGCCCTTAACCATCGAGATAAAGGATAGGTTACAGTTACGGGTGCTCTTGCGTCGGGAAGACGTCGTCCTGGGGAGGCCTATGACCCCCACCCAGATAGGCCCAAGCCTGCTGCCTATCATGTGGCAGCTCTACCCTGATGGACGATACCGATCCTCAGACTCCAGTTTCTGGCGCTTAGTGTACCACATCAAGATTGACGGCGTGGAGGACATGCTTCTCGAGCTGCTGCCAGATGACTGA
ORF Protein Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T84671-Ab Anti-TCL1A monoclonal antibody
    Target Antigen GM-Tg-g-T84671-Ag TCL1A protein
    ORF Viral Vector pGMLP000066 Human TCL1A Lentivirus plasmid
    ORF Viral Vector vGMLP000066 Human TCL1A Lentivirus particle


    Target information

    Target ID GM-T84671
    Target Name TCL1A
    Gene ID 8115, 21432, 703349, 101090193, 119872954, 506540, 100630002
    Gene Symbol and Synonyms TCL1,TCL1A
    Uniprot Accession P56279
    Uniprot Entry Name TCL1A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000100721
    Target Classification Tumor-associated antigen (TAA)

    Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.