Human TCTA ORF/cDNA clone-Lentivirus plasmid (NM_022171)

Cat. No.: pGMLP000067
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TCTA/ Lentiviral expression plasmid for TCTA lentivirus packaging, TCTA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TCTA/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000067
Gene Name TCTA
Accession Number NM_022171
Gene ID 6988
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 312 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAGTCCTGGTCTGGGCAGGCCTTGCAGGCTCTGCCGGCCACGGTGCTGGGCGCGCTGGGCAGCGAGTTCTTGCGGGAGTGGGAGGCGCAGGACATGCGCGTGACCCTCTTCAAGCTGCTGCTGCTGTGGTTGGTGTTAAGTCTCCTGGGCATCCAGCTGGCGTGGGGGTTCTACGGGAATACAGTGACCGGGTTGTATCACCGTCCAGGTCTGGGTGGTCAGAATGGATCCACGCCTGATGGCTCCACGCATTTCCCTTCGTGGGAAATGGCAGCAAACGAACCTCTCAAAACCCACAGAGAATAA
ORF Protein Sequence MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1897-Ab Anti-TCTA monoclonal antibody
    Target Antigen GM-Tg-g-IP1897-Ag TCTA protein
    ORF Viral Vector pGMLP000067 Human TCTA Lentivirus plasmid
    ORF Viral Vector vGMLP000067 Human TCTA Lentivirus particle


    Target information

    Target ID GM-IP1897
    Target Name TCTA
    Gene ID 6988, 102791, 706633, 306587, 101084522, 608826, 616169, 100053301
    Gene Symbol and Synonyms 9130410M22Rik,TCTA,Tctal
    Uniprot Accession P57738
    Uniprot Entry Name TCTA_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000145022
    Target Classification Tumor-associated antigen (TAA)

    Involved in negative regulation of osteoclast differentiation and osteoclast fusion. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.