Human ARRB1/ARB1/ARR1 ORF/cDNA clone-Lentivirus plasmid (NM_004041)
Cat. No.: pGMLP000106
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ARRB1/ARB1/ARR1 Lentiviral expression plasmid for ARRB1 lentivirus packaging, ARRB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
ARRB1/ARB1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000106 |
Gene Name | ARRB1 |
Accession Number | NM_004041 |
Gene ID | 408 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1257 bp |
Gene Alias | ARB1,ARR1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGATCCCTCCAAACCTTCCATGTTCTGTGACACTGCAGCCGGGGCCCGAAGACACGGGGAAGGCTTGCGGTGTGGACTATGAAGTCAAAGCCTTCTGCGCGGAGAATTTGGAGGAGAAGATCCACAAGCGGAATTCTGTGCGTCTGGTCATCCGGAAGGTTCAGTATGCCCCAGAGAGGCCTGGCCCCCAGCCCACAGCCGAGACCACCAGGCAGTTCCTCATGTCGGACAAGCCCTTGCACCTAGAAGCCTCTCTGGATAAGGAGATCTATTACCATGGAGAACCCATCAGCGTCAACGTCCACGTCACCAACAACACCAACAAGACGGTGAAGAAGATCAAGATCTCAGTGCGCCAGTATGCAGACATCTGCCTTTTCAACACAGCTCAGTACAAGTGCCCTGTTGCCATGGAAGAGGCTGATGACACTGTGGCACCCAGCTCGACGTTCTGCAAGGTCTACACACTGACCCCCTTCCTAGCCAATAACCGAGAGAAGCGGGGCCTCGCCTTGGACGGGAAGCTCAAGCACGAAGACACGAACTTGGCCTCTAGCACCCTGTTGAGGGAAGGTGCCAACCGTGAGATCCTGGGGATCATTGTTTCCTACAAAGTGAAAGTGAAGCTGGTGGTGTCTCGGGGCGGCCTGTTGGGAGATCTTGCATCCAGCGACGTGGCCGTGGAACTGCCCTTCACCCTAATGCACCCCAAGCCCAAAGAGGAACCCCCGCATCGGGAAGTTCCAGAGAACGAGACGCCAGTAGATACCAATCTCATAGAACTTGACACAAATGATGACGACATTGTATTTGAGGACTTTGCTCGCCAGAGACTGAAAGGCATGAAGGATGACAAGGAGGAAGAGGAGGATGGTACCGGCTCTCCACAGCTCAACAACAGATAG |
ORF Protein Sequence | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T41646-Ab | Anti-ARRB1 monoclonal antibody |
Target Antigen | GM-Tg-g-T41646-Ag | ARRB1 protein |
ORF Viral Vector | pGMLP000106 | Human ARRB1 Lentivirus plasmid |
ORF Viral Vector | vGMLP000106 | Human ARRB1 Lentivirus particle |
Target information
Target ID | GM-T41646 |
Target Name | ARRB1 |
Gene ID | 408, 109689, 695250, 25387, 101101078, 485189, 281637, 100064657 |
Gene Symbol and Synonyms | 1200006I17Rik,ARB1,ARR1,ARRB1,BARRES,G430100A01Rik |
Uniprot Accession | P49407 |
Uniprot Entry Name | ARRB1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000137486 |
Target Classification | Not Available |
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. [provided by RefSeq, Jan 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.