Human TPST2/TANGO13B ORF/cDNA clone-Lentivirus plasmid (NM_003595)

Cat. No.: pGMLP000135
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TPST2/TANGO13B Lentiviral expression plasmid for TPST2 lentivirus packaging, TPST2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TPST2/TANGO13B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $617.52
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000135
Gene Name TPST2
Accession Number NM_003595
Gene ID 8459
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1134 bp
Gene Alias TANGO13B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGCCTGTCGGTGCGGAGGGTGCTGCTGGCAGCCGGCTGCGCCCTGGTCCTGGTGCTGGCGGTTCAGCTGGGACAGCAGGTGCTAGAGTGCCGGGCGGTGCTGGCGGGCCTGCGGAGCCCCCGGGGGGCCATGCGGCCTGAGCAGGAGGAGCTGGTGATGGTGGGCACCAACCACGTGGAATACCGCTATGGCAAGGCCATGCCGCTCATCTTCGTGGGTGGCGTGCCTCGCAGTGGCACCACGTTGATGCGCGCCATGCTGGACGCGCACCCCGAGGTGCGCTGCGGCGAGGAGACCCGCATCATCCCGCGCGTGCTGGCCATGCGCCAGGCCTGGTCCAAGTCTGGCCGTGAGAAGCTGCGGCTGGATGAGGCGGGGGTGACGGATGAGGTGCTGGACGCCGCCATGCAGGCCTTCATCCTGGAGGTGATTGCCAAGCACGGAGAGCCGGCCCGCGTGCTCTGCAACAAGGACCCATTTACGCTCAAGTCCTCGGTCTACCTGTCGCGCCTGTTCCCCAACTCCAAGTTCCTGCTGATGGTGCGGGACGGCCGGGCCTCCGTGCACTCCATGATCACGCGCAAAGTCACCATTGCGGGCTTTGACCTCAGCAGCTACCGTGACTGCCTCACCAAGTGGAACAAGGCCATCGAGGTGATGTACGCCCAGTGCATGGAGGTAGGCAAGGAGAAGTGCCTGCCTGTGTACTACGAGCAGCTGGTGCTGCACCCCAGGCGCTCACTCAAGCTCATCCTCGACTTCCTCGGCATCGCCTGGAGCGACGCTGTCCTCCACCATGAAGACCTCATTGGCAAGCCCGGTGGTGTCTCCCTGTCCAAGATCGAGCGGTCCACGGACCAGGTCATCAAGCCTGTTAACCTGGAAGCGCTCTCCAAGTGGACTGGCCACATCCCTGGGGATGTGGTGCGGGACATGGCCCAGATCGCCCCCATGCTGGCTCAGCTCGGCTATGACCCTTATGCAAACCCCCCCAACTATGGCAACCCTGACCCCTTCGTCATCAACAACACACAGCGGGTCTTGAAAGGGGACTATAAAACACCAGCCAATCTGAAAGGATATTTTCAGGTGAACCAGAACAGCACCTCCTCCCACTTAGGAAGCTCGTGA
ORF Protein Sequence MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0524-Ab Anti-TPST2/ TANGO13B/ TPST-2 functional antibody
    Target Antigen GM-Tg-g-SE0524-Ag TPST2 protein
    ORF Viral Vector pGMLP000135 Human TPST2 Lentivirus plasmid
    ORF Viral Vector vGMLP000135 Human TPST2 Lentivirus particle


    Target information

    Target ID GM-SE0524
    Target Name TPST2
    Gene ID 8459, 22022, 715338, 288719, 101091155, 486332, 540183, 100059398
    Gene Symbol and Synonyms D5Ucla3,grm,grt,TANGO13B,TPST-2,TPST2
    Uniprot Accession O60704
    Uniprot Entry Name TPST2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000128294
    Target Classification Not Available

    The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.