Human TPST2/TANGO13B ORF/cDNA clone-Lentivirus plasmid (NM_003595)
Cat. No.: pGMLP000135
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TPST2/TANGO13B Lentiviral expression plasmid for TPST2 lentivirus packaging, TPST2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TPST2/TANGO13B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000135 |
Gene Name | TPST2 |
Accession Number | NM_003595 |
Gene ID | 8459 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1134 bp |
Gene Alias | TANGO13B |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCGCCTGTCGGTGCGGAGGGTGCTGCTGGCAGCCGGCTGCGCCCTGGTCCTGGTGCTGGCGGTTCAGCTGGGACAGCAGGTGCTAGAGTGCCGGGCGGTGCTGGCGGGCCTGCGGAGCCCCCGGGGGGCCATGCGGCCTGAGCAGGAGGAGCTGGTGATGGTGGGCACCAACCACGTGGAATACCGCTATGGCAAGGCCATGCCGCTCATCTTCGTGGGTGGCGTGCCTCGCAGTGGCACCACGTTGATGCGCGCCATGCTGGACGCGCACCCCGAGGTGCGCTGCGGCGAGGAGACCCGCATCATCCCGCGCGTGCTGGCCATGCGCCAGGCCTGGTCCAAGTCTGGCCGTGAGAAGCTGCGGCTGGATGAGGCGGGGGTGACGGATGAGGTGCTGGACGCCGCCATGCAGGCCTTCATCCTGGAGGTGATTGCCAAGCACGGAGAGCCGGCCCGCGTGCTCTGCAACAAGGACCCATTTACGCTCAAGTCCTCGGTCTACCTGTCGCGCCTGTTCCCCAACTCCAAGTTCCTGCTGATGGTGCGGGACGGCCGGGCCTCCGTGCACTCCATGATCACGCGCAAAGTCACCATTGCGGGCTTTGACCTCAGCAGCTACCGTGACTGCCTCACCAAGTGGAACAAGGCCATCGAGGTGATGTACGCCCAGTGCATGGAGGTAGGCAAGGAGAAGTGCCTGCCTGTGTACTACGAGCAGCTGGTGCTGCACCCCAGGCGCTCACTCAAGCTCATCCTCGACTTCCTCGGCATCGCCTGGAGCGACGCTGTCCTCCACCATGAAGACCTCATTGGCAAGCCCGGTGGTGTCTCCCTGTCCAAGATCGAGCGGTCCACGGACCAGGTCATCAAGCCTGTTAACCTGGAAGCGCTCTCCAAGTGGACTGGCCACATCCCTGGGGATGTGGTGCGGGACATGGCCCAGATCGCCCCCATGCTGGCTCAGCTCGGCTATGACCCTTATGCAAACCCCCCCAACTATGGCAACCCTGACCCCTTCGTCATCAACAACACACAGCGGGTCTTGAAAGGGGACTATAAAACACCAGCCAATCTGAAAGGATATTTTCAGGTGAACCAGAACAGCACCTCCTCCCACTTAGGAAGCTCGTGA |
ORF Protein Sequence | MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0524-Ab | Anti-TPST2/ TANGO13B/ TPST-2 functional antibody |
Target Antigen | GM-Tg-g-SE0524-Ag | TPST2 protein |
ORF Viral Vector | pGMLP000135 | Human TPST2 Lentivirus plasmid |
ORF Viral Vector | vGMLP000135 | Human TPST2 Lentivirus particle |
Target information
Target ID | GM-SE0524 |
Target Name | TPST2 |
Gene ID | 8459, 22022, 715338, 288719, 101091155, 486332, 540183, 100059398 |
Gene Symbol and Synonyms | D5Ucla3,grm,grt,TANGO13B,TPST-2,TPST2 |
Uniprot Accession | O60704 |
Uniprot Entry Name | TPST2_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000128294 |
Target Classification | Not Available |
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.