Human BAGE/BAGE1/CT2.1 ORF/cDNA clone-Lentivirus plasmid (NM_001187)

Cat. No.: pGMLP000207
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BAGE/BAGE1/CT2.1 Lentiviral expression plasmid for BAGE lentivirus packaging, BAGE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BAGE/BAGE1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000207
Gene Name BAGE
Accession Number NM_001187
Gene ID 574
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 132 bp
Gene Alias BAGE1,CT2.1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCAGAGCGGTTTTTCTGGCATTGTCTGCCCAGCTGCTCCAAGCCAGGCTGATGAAGGAGGAGTCCCCTGTGGTGAGCTGGAGGTTGGAGCCTGAAGACGGCACAGCTCTGTGCTTCATCTTCTGA
ORF Protein Sequence MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T18571-Ab Anti-BAGE monoclonal antibody
    Target Antigen GM-Tg-g-T18571-Ag BAGE protein
    ORF Viral Vector pGMLP000207 Human BAGE Lentivirus plasmid
    ORF Viral Vector vGMLP000207 Human BAGE Lentivirus particle


    Target information

    Target ID GM-T18571
    Target Name BAGE
    Gene ID 574
    Gene Symbol and Synonyms BAGE,BAGE1,CT2.1
    Uniprot Accession Q13072
    Uniprot Entry Name BAGE1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000268590
    Target Classification Not Available

    This gene encodes a tumor antigen recognized by autologous cytolytic lymphocytes (CTL). [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.