Human UBE2D4/HBUCE1 ORF/cDNA clone-Lentivirus plasmid (NM_015983)

Cat. No.: pGMLP000217
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2D4/HBUCE1 Lentiviral expression plasmid for UBE2D4 lentivirus packaging, UBE2D4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to UBE2D4/HBUCE1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000217
Gene Name UBE2D4
Accession Number NM_015983
Gene ID 51619
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias HBUCE1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCTAAAGCGGATCCAGAAGGAATTAACCGACTTGCAGAGGGATCCTCCTGCCCAGTGTTCTGCAGGACCTGTCGGTGATGACTTGTTCCACTGGCAGGCCACCATCATGGGCCCGAATGACAGTCCTTACCAAGGAGGTGTTTTCTTCCTGACCATCCACTTTCCTACAGATTACCCGTTCAAGCCCCCAAAGGTTGCTTTCACAACCAAAATTTATCACCCTAATATCAACAGCAATGGCAGCATCTGCCTTGATATCCTGCGGTCTCAGTGGTCTCCAGCGTTGACTGTGTCAAAAGTTCTCTTGTCCATCTGCTCGCTGCTCTGCGACCCCAACCCCGATGACCCCCTGGTGCCAGAGATAGCACACACCTACAAGGCCGACAGAGAGAAGTACAACAGACTAGCAAGAGAGTGGACACAAAAATATGCTATGTAA
ORF Protein Sequence MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2797-Ab Anti-UBE2D4 monoclonal antibody
    Target Antigen GM-Tg-g-IP2797-Ag UBE2D4 protein
    ORF Viral Vector pGMLP000217 Human UBE2D4 Lentivirus plasmid
    ORF Viral Vector vGMLP000217 Human UBE2D4 Lentivirus particle


    Target information

    Target ID GM-IP2797
    Target Name UBE2D4
    Gene ID 51619, 707831, 108352787, 511801, 100064918
    Gene Symbol and Synonyms HBUCE1,UBE2D4,Ube2d4-ps 1,Ube2d4l-ps2
    Uniprot Accession Q9Y2X8
    Uniprot Entry Name UB2D4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000078967
    Target Classification Not Available

    Enables ubiquitin conjugating enzyme activity. Involved in protein polyubiquitination. Acts upstream of or within protein ubiquitination. Predicted to be part of ubiquitin ligase complex. Predicted to be active in nucleus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.