Human RPRM/REPRIMO ORF/cDNA clone-Lentivirus plasmid (NM_019845)

Cat. No.: pGMLP000221
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RPRM/REPRIMO Lentiviral expression plasmid for RPRM lentivirus packaging, RPRM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RPRM/REPRIMO products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000221
Gene Name RPRM
Accession Number NM_019845
Gene ID 56475
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 330 bp
Gene Alias REPRIMO
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCCGGCCCTAGGCAACCAGACGGACGTGGCGGGCCTGTTCCTGGCCAACAGCAGCGAGGCGCTGGAGCGAGCCGTGCGCTGCTGCACCCAGGCGTCCGTGGTGACCGACGACGGCTTCGCGGAGGGAGGCCCGGACGAGCGTAGCCTGTACATAATGCGCGTGGTGCAGATCGCGGTCATGTGCGTGCTCTCACTCACCGTGGTCTTCGGCATCTTCTTCCTCGGCTGCAATCTGCTCATCAAGTCCGAGGGCATGATCAACTTCCTCGTGAAGGACCGGAGGCCGTCTAAGGAGGTGGAGGCGGTGGTCGTGGGGCCCTACTGA
ORF Protein Sequence MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1552-Ab Anti-RPRM monoclonal antibody
    Target Antigen GM-Tg-g-IP1552-Ag RPRM protein
    ORF Viral Vector pGMLP000221 Human RPRM Lentivirus plasmid
    ORF Viral Vector vGMLP000221 Human RPRM Lentivirus particle


    Target information

    Target ID GM-IP1552
    Target Name RPRM
    Gene ID 56475, 67874, 696097, 680110, 101087679, 119867787, 614739, 100058360
    Gene Symbol and Synonyms 2410012A13Rik,REPRIMO,RPRM
    Uniprot Accession Q9NS64
    Uniprot Entry Name RPRM_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000177519
    Target Classification Not Available

    Predicted to be involved in regulation of mitotic cell cycle. Predicted to act upstream of or within regulation of cell cycle. Predicted to be integral component of membrane. Predicted to be active in cytoplasm. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.