Human NDUFA13/B16.6/CDA016 ORF/cDNA clone-Lentivirus plasmid (NM_015965)

Cat. No.: pGMLP000328
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NDUFA13/B16.6/CDA016 Lentiviral expression plasmid for NDUFA13 lentivirus packaging, NDUFA13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NDUFA13/B16.6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000328
Gene Name NDUFA13
Accession Number NM_015965
Gene ID 51079
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 435 bp
Gene Alias B16.6,CDA016,CGI-39,GRIM-19,GRIM19
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGTCAAAGGTGAAGCAGGACATGCCTCCGCCGGGGGGCTATGGGCCCATCGACTACAAACGGAACTTGCCGCGTCGAGGACTGTCGGGCTACAGCATGCTGGCCATAGGGATTGGAACCCTGATCTACGGGCACTGGAGCATAATGAAGTGGAACCGTGAGCGCAGGCGCCTACAAATCGAGGACTTCGAGGCTCGCATCGCGCTGTTGCCACTGTTACAGGCAGAAACCGACCGGAGGACCTTGCAGATGCTTCGGGAGAACCTGGAGGAGGAGGCCATCATCATGAAGGACGTGCCCGACTGGAAGGTGGGGGAGTCTGTGTTCCACACAACCCGCTGGGTGCCCCCCTTGATCGGGGAGCTGTACGGGCTGCGCACCACAGAGGAGGCTCTCCATGCCAGCCACGGCTTCATGTGGTACACGTAG
ORF Protein Sequence MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0083-Ab Anti-NDUFA13 monoclonal antibody
    Target Antigen GM-Tg-g-IP0083-Ag NDUFA13 protein
    ORF Viral Vector pGMLP000328 Human NDUFA13 Lentivirus plasmid
    ORF Viral Vector vGMLP000328 Human NDUFA13 Lentivirus particle


    Target information

    Target ID GM-IP0083
    Target Name NDUFA13
    Gene ID 51079, 67184, 716666, 100911483, 101100189, 476659, 338084, 100146253
    Gene Symbol and Synonyms 2700054G14Rik,B16.6,CDA016,CGI-39,CI-B16.6,GRIM-19,GRIM19,MC1DN28,NDUFA13,Ndufa13-ps
    Uniprot Accession Q9P0J0
    Uniprot Entry Name NDUAD_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000186010
    Target Classification Not Available

    This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.