Human GAGE12B/GAGE-12B ORF/cDNA clone-Lentivirus plasmid (NM_001127345)

Cat. No.: pGMLP000398
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GAGE12B/GAGE-12B Lentiviral expression plasmid for GAGE12B lentivirus packaging, GAGE12B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GAGE12C/GAGE12B/GAGE-12B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000398
Gene Name GAGE12B
Accession Number NM_001127345
Gene ID 729428
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 354 bp
Gene Alias GAGE-12B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTTGGCGAGGAAGATCGACCTATTATTGGCCTAGACCAAGGCGCTATGTACAGCCTCCTGAAATGATTGGGCCTATGCGGCCCGAGCAGTTCAGTGATGAAGTGGAACCAGCAACACCTGAAGAAGGGGAACCAGCAACTCAACGTCAGGATCCTGCAGCTGCTCAGGAGGGAGAGGATGAGGGAGCATCTGCAGGTCAAGGGCCGAAGCCTGAAGCTCATAGCCAGGAACAGGGTCACCCACAGACTGGGTGTGAGTGTGAAGATGGTCCTGATGGGCAGGAGATGGACCCGCCAAATCCAGAGGAGGTGAAAACGCCTGAAGAAGGTGAAAAGCAATCACAGTGTTAA
ORF Protein Sequence MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2511-Ab Anti-GAGE12C monoclonal antibody
    Target Antigen GM-Tg-g-IP2511-Ag GAGE12C protein
    ORF Viral Vector pGMLP000398 Human GAGE12B Lentivirus plasmid
    ORF Viral Vector vGMLP000398 Human GAGE12B Lentivirus particle


    Target information

    Target ID GM-IP2511
    Target Name GAGE12C
    Gene ID 729422
    Gene Symbol and Synonyms GAGE-12B,GAGE12C
    Uniprot Accession A1L429
    Uniprot Entry Name GG12C_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000237671
    Target Classification Not Available



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.