Human PRL/GHA1 ORF/cDNA clone-Lentivirus plasmid (NM_000948)

Cat. No.: pGMLP000455
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRL/GHA1 Lentiviral expression plasmid for PRL lentivirus packaging, PRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRL/GHA1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $471
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000455
Gene Name PRL
Accession Number NM_000948
Gene ID 5617
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 684 bp
Gene Alias GHA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACATCAAAGGATCGCCATGGAAAGGGTCCCTCCTGCTGCTGCTGGTGTCAAACCTGCTCCTGTGCCAGAGCGTGGCCCCCTTGCCCATCTGTCCCGGCGGGGCTGCCCGATGCCAGGTGACCCTTCGAGACCTGTTTGACCGCGCCGTCGTCCTGTCCCACTACATCCATAACCTCTCCTCAGAAATGTTCAGCGAATTCGATAAACGGTATACCCATGGCCGGGGGTTCATTACCAAGGCCATCAACAGCTGCCACACTTCTTCCCTTGCCACCCCCGAAGACAAGGAGCAAGCCCAACAGATGAATCAAAAAGACTTTCTGAGCCTGATAGTCAGCATATTGCGATCCTGGAATGAGCCTCTGTATCATCTGGTCACGGAAGTACGTGGTATGCAAGAAGCCCCGGAGGCTATCCTATCCAAAGCTGTAGAGATTGAGGAGCAAACCAAACGGCTTCTAGAGGGCATGGAGCTGATAGTCAGCCAGGTTCATCCTGAAACCAAAGAAAATGAGATCTACCCTGTCTGGTCGGGACTTCCATCCCTGCAGATGGCTGATGAAGAGTCTCGCCTTTCTGCTTATTATAACCTGCTCCACTGCCTACGCAGGGATTCACATAAAATCGACAATTATCTCAAGCTCCTGAAGTGCCGAATCATCCACAACAACAACTGCTAA
ORF Protein Sequence MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T32282-Ab Anti-PRL/ GHA1 functional antibody
    Target Antigen GM-Tg-g-T32282-Ag PRL protein
    ORF Viral Vector pGMLP000455 Human PRL Lentivirus plasmid
    ORF Viral Vector pGMAP000270 Human PRL Adenovirus plasmid
    ORF Viral Vector vGMLP000455 Human PRL Lentivirus particle
    ORF Viral Vector vGMAP000270 Human PRL Adenovirus particle


    Target information

    Target ID GM-T32282
    Target Name PRL
    Gene ID 5617, 707052, 24683, 751517, 488241, 280901, 100034034
    Gene Symbol and Synonyms GHA1,PRL,Prl1a1,PRLB,PRLSD1,Prol,RATPRLSD1,RNPROL
    Uniprot Accession P01236
    Uniprot Entry Name PRL_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Breast Cancer, ovarian cancer, Prolactinoma (kidney), tumor, Manganese toxicity, Nervous system function
    Gene Ensembl ENSG00000172179
    Target Classification Not Available

    This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.