Human MLST8/GbetaL/GBL ORF/cDNA clone-Lentivirus plasmid (NM001199174)

Cat. No.: pGMLP000588
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MLST8/GbetaL/GBL Lentiviral expression plasmid for MLST8 lentivirus packaging, MLST8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MLST8/GbetaL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $545.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000588
Gene Name MLST8
Accession Number NM001199174
Gene ID 64223
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 981 bp
Gene Alias GbetaL,GBL,LST8,POP3,WAT1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACACCTCCCCAGGCACGGTGGGCAGTGACCCGGTCATCCTGGCCACTGCAGGCTACGACCACACCGTGCGCTTCTGGCAGGCCCACAGCGGCATCTGCACCCGGACGGTGCAGCACCAGGACTCCCAGGTGAATGCCTTGGAGGTCACACCGGACCGCAGCATGATTGCTGCTGCAGGTTACCAGCACATCCGCATGTATGATCTCAACTCCAATAACCCTAACCCCATCATCAGCTACGACGGCGTCAACAAGAACATCGCGTCTGTGGGCTTCCACGAAGACGGCCGCTGGATGTACACGGGCGGCGAGGACTGCACAGCCAGGATCTGGGACCTCAGGTCCCGGAACCTGCAGTGCCAGCGGATCTTCCAGGTGAACGCACCCATTAACTGCGTGTGCCTGCACCCCAACCAGGCAGAGCTCATCGTGGGTGACCAGAGCGGGGCTATCCACATCTGGGACTTGAAAACAGACCACAACGAGCAGCTGATCCCTGAGCCCGAGGTCTCCATCACGTCCGCCCACATCGATCCCGACGCCAGCTACATGGCAGCTGTCAATAGCACCGGAAACTGCTATGTCTGGAATCTGACGGGGGGCATTGGTGACGAGGTGACCCAGCTCATCCCCAAGACTAAGATCCCTGCCCACACGCGCTACGCCCTGCAGTGTCGCTTCAGCCCCGACTCCACGCTCCTCGCCACCTGCTCGGCTGATCAGACGTGCAAGATCTGGAGGACGTCCAACTTCTCCCTGATGACGGAGCTGAGCATCAAGAGCGGCAACCCCGGGGAGTCCTCCCGCGGCTGGATGTGGGGCTGCGCCTTCTCGGGGGACTCCCAGTACATCGTCACTGCTTCCTCGGACAACCTGGCCCGGCTCTGGTGTGTGGAGACTGGAGAGATCAAGAGAGAGTATGGCGGCCACCAGAAGGCTGTTGTCTGCCTGGCCTTCAATGACAGTGTGCTGGGCTAG
ORF Protein Sequence MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2601-Ab Anti-MLST8 monoclonal antibody
    Target Antigen GM-Tg-g-IP2601-Ag MLST8 protein
    ORF Viral Vector pGMLP000588 Human MLST8 Lentivirus plasmid
    ORF Viral Vector pGMLP005594 Human MLST8 Lentivirus plasmid
    ORF Viral Vector vGMLP000588 Human MLST8 Lentivirus particle
    ORF Viral Vector vGMLP005594 Human MLST8 Lentivirus particle


    Target information

    Target ID GM-IP2601
    Target Name MLST8
    Gene ID 64223, 56716, 695650, 64226, 101081776, 610936, 535236, 100146703
    Gene Symbol and Synonyms 0610033N12Rik,GbetaL,GBL,LST8,MLST8,POP3,WAT1
    Uniprot Accession Q9BVC4
    Uniprot Entry Name LST8_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000167965
    Target Classification Not Available

    Enables protein serine/threonine kinase activator activity. Involved in TORC1 signaling; positive regulation of TOR signaling; and regulation of actin cytoskeleton organization. Part of TORC1 complex and TORC2 complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.