Human JTB/hJT/HJTB ORF/cDNA clone-Lentivirus plasmid (NM_006694)

Cat. No.: pGMLP000635
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human JTB/hJT/HJTB Lentiviral expression plasmid for JTB lentivirus packaging, JTB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to JTB/hJT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000635
Gene Name JTB
Accession Number NM_006694
Gene ID 10899
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 441 bp
Gene Alias hJT,HJTB,HSPC222,PAR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTTGCGGGTGCCGGGAGGCCTGGCCTCCCCCAGGGCCGCCACCTCTGCTGGTTGCTCTGTGCTTTCACCTTAAAGCTCTGCCAAGCAGAGGCTCCCGTGCAGGAAGAGAAGCTGTCAGCAAGCACCTCAAATTTGCCATGCTGGCTGGTGGAAGAGTTTGTGGTAGCAGAAGAGTGCTCTCCATGCTCTAATTTCCGGGCTAAAACTACCCCTGAGTGTGGTCCCACAGGATATGTAGAGAAAATCACATGCAGCTCATCTAAGAGAAATGAGTTCAAAAGCTGCCGCTCAGCTTTGATGGAACAACGCTTATTTTGGAAGTTCGAAGGGGCTGTCGTGTGTGTGGCCCTGATCTTCGCTTGTCTTGTCATCATTCGTCAGCGACAATTGGACAGAAAGGCTCTGGAAAAGGTCCGGAAGCAAATCGAGTCCATATAG
ORF Protein Sequence MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1033-Ab Anti-JTB monoclonal antibody
    Target Antigen GM-Tg-g-IP1033-Ag JTB protein
    ORF Viral Vector pGMLP000635 Human JTB Lentivirus plasmid
    ORF Viral Vector vGMLP000635 Human JTB Lentivirus particle


    Target information

    Target ID GM-IP1033
    Target Name JTB
    Gene ID 10899, 23922, 718537, 29439, 101100181, 612300, 513970, 100056619
    Gene Symbol and Synonyms Gm622,hJT,HJTB,HSPC222,JTB,PAR
    Uniprot Accession O76095
    Uniprot Entry Name JTB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143543
    Target Classification Not Available

    Enables protein kinase binding activity. Involved in mitotic cytokinesis and positive regulation of protein kinase activity. Located in cytoplasm and midbody. Colocalizes with centrosome and spindle. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.