Human PLLP/PMLP/TM4SF11 ORF/cDNA clone-Lentivirus plasmid (NM_015993)

Cat. No.: pGMLP000672
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PLLP/PMLP/TM4SF11 Lentiviral expression plasmid for PLLP lentivirus packaging, PLLP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PLLP/PMLP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $437.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000672
Gene Name PLLP
Accession Number NM_015993
Gene ID 51090
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 549 bp
Gene Alias PMLP,TM4SF11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGTTCCCGTCGAAAGTTAGCACGCGGACCAGCAGTCCTGCGCAGGGCGCCGAAGCCTCGGTGTCGGCGCTGCGCCCGGACCTGGGCTTCGTGCGCTCCCGCCTCGGGGCGCTCATGCTGCTGCAGCTGGTGCTGGGGCTGCTGGTGTGGGCGCTGATTGCGGACACCCCGTACCACCTGTATCCGGCCTATGGCTGGGTGATGTTCGTCGCTGTCTTCCTCTGGCTGGTGACAATCGTCCTCTTCAACCTCTACCTGTTTCAGCTGCACATGAAGTTGTACATGGTTCCCTGGCCACTGGTGTTAATGATCTTTAACATCAGCGCCACCGTTCTCTACATCACCGCCTTCATCGCCTGCTCTGCGGCAGTTGACCTGACATCCCTGAGGGGCACCCGGCCTTATAACCAGCGCGCGGCTGCCTCGTTCTTTGCGTGTTTGGTGATGATCGCCTATGGAGTGAGTGCCTTCTTCAGCTACCAGGCCTGGCGAGGAGTAGGCAGCAATGCGGCCACCAGTCAGATGGCTGGCGGCTATGCCTAA
ORF Protein Sequence MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1415-Ab Anti-PLLP monoclonal antibody
    Target Antigen GM-Tg-g-IP1415-Ag PLLP protein
    ORF Viral Vector pGMLP000672 Human PLLP Lentivirus plasmid
    ORF Viral Vector vGMLP000672 Human PLLP Lentivirus particle


    Target information

    Target ID GM-IP1415
    Target Name PLLP
    Gene ID 51090, 67801, 704120, 64364, 101084409, 100685289, 613446, 100062302
    Gene Symbol and Synonyms 0610010I06Rik,Plapi,PLLP,PMLP,TM4SF11
    Uniprot Accession Q9Y342
    Uniprot Entry Name PLLP_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000102934
    Target Classification Ion Channel

    Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in compact myelin and membrane raft. Predicted to be integral component of membrane. Biomarker of schizophrenia. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.