Human UPP1/UDRPASE/UP ORF/cDNA clone-Lentivirus plasmid (NM_001287429.1)

Cat. No.: pGMLP000712
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UPP1/UDRPASE/UP Lentiviral expression plasmid for UPP1 lentivirus packaging, UPP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to UPP1/UDRPASE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $430.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000712
Gene Name UPP1
Accession Number NM_001287429.1
Gene ID 7378
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 522 bp
Gene Alias UDRPASE,UP,UPASE,UPP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGAGAAAGCTGAAAGTCACAAGTCTGGAGCCCGGCACTGTGGTCATAACAGAGCAGGCAGTGGATACCTGCTTCAAGGCAGAGTTTGAGCAGATTGTCCTGGGGAAGCGGGTCATCCGGAAAACGGACCTTAACAAGAAGCTGGTGCAGGAGCTGTTGCTGTGTTCTGCAGAGCTGAGCGAGTTCACCACAGTGGTGGGGAACACCATGTGCACCTTGGACTTCTATGAAGGGCAAGGCCGTCTGGATGGGGCTCTCTGCTCCTACACGGAGAAGGACAAGCAGGCGTATCTGGAGGCAGCCTATGCAGCCGGCGTCCGCAATATCGAGATGGAGTCCTCGGTGTTTGCCGCCATGTGCAGCGCCTGCGGCCTCCAAGCGGCCGTGGTGTGTGTCACCCTCCTGAACCGCCTGGAAGGGGACCAGATCAGCAGCCCTCGCAATGTGCTCAGCGAGTACCAGCAGAGGCCGCAGCGGCTGGTGAGCTACTTCATCAAGAAGAAACTGAGCAAGGCCTGA
ORF Protein Sequence MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA052-Ab Anti-UPP1 monoclonal antibody
    Target Antigen GM-Tg-g-TA052-Ag UPP1 protein
    ORF Viral Vector pGMLP000712 Human UPP1 Lentivirus plasmid
    ORF Viral Vector pGMAD001503 Human UPP1 Adenovirus plasmid
    ORF Viral Vector vGMLP000712 Human UPP1 Lentivirus particle
    ORF Viral Vector vGMAD001503 Human UPP1 Adenovirus particle


    Target information

    Target ID GM-TA052
    Target Name UPP1
    Gene ID 7378, 22271, 695317, 289801, 101082223, 480772, 515029, 100052199
    Gene Symbol and Synonyms UDRPASE,UP,UPASE,UPP,UPP1
    Uniprot Accession Q16831
    Uniprot Entry Name UPP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000183696
    Target Classification Not Available

    This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.