Human TUSC2/C3orf11/FUS1 ORF/cDNA clone-Lentivirus plasmid (NM_007275.2)

Cat. No.: pGMLP000717
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TUSC2/C3orf11/FUS1 Lentiviral expression plasmid for TUSC2 lentivirus packaging, TUSC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TUSC2/C3orf11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000717
Gene Name TUSC2
Accession Number NM_007275.2
Gene ID 11334
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 333 bp
Gene Alias C3orf11,FUS1,PAP,PDAP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCGCCAGCGGGTCCAAAGCTCGGGGCCTGTGGCCCTTCGCCTCGGCGGCCGGAGGCGGCGGCTCAGAGGCAGCAGGAGCTGAGCAAGCTTTGGTGCGGCCTCGGGGCCGAGCTGTGCCCCCCTTCGTATTCACGCGCCGCGGCTCTATGTTCTATGATGAGGATGGGGATCTGGCTCACGAGTTCTATGAGGAGACAATCGTCACCAAGAACGGGCAGAAGCGGGCCAAGCTGAGGCGAGTGCATAAGAATCTGATTCCTCAGGGCATCGTGAAGCTGGATCACCCCCGCATCCACGTGGATTTCCCTGTGATCCTCTATGAGGTGTGA
ORF Protein Sequence MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T83376-Ab Anti-TUSC2 monoclonal antibody
    Target Antigen GM-Tg-g-T83376-Ag TUSC2 protein
    ORF Viral Vector pGMLP000717 Human TUSC2 Lentivirus plasmid
    ORF Viral Vector vGMLP000717 Human TUSC2 Lentivirus particle


    Target information

    Target ID GM-T83376
    Target Name TUSC2
    Gene ID 11334, 80385, 702614, 501052, 101094407, 608576, 100848754, 100052473
    Gene Symbol and Synonyms 1190001E22Rik,C3orf11,FUS1,Lgcc,PAP,PDAP2,TUSC2
    Uniprot Accession O75896
    Uniprot Entry Name TUSC2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000114383
    Target Classification Tumor-associated antigen (TAA)

    This gene is a highly conserved lung cancer candidate gene. No other information about this gene is currently available. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.