Human CTDNEP1/DULLARD/HSA011916 ORF/cDNA clone-Lentivirus plasmid (NM_001143775)

Cat. No.: pGMLP000911
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CTDNEP1/DULLARD/HSA011916 Lentiviral expression plasmid for CTDNEP1 lentivirus packaging, CTDNEP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CTDNEP1/DULLARD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000911
Gene Name CTDNEP1
Accession Number NM_001143775
Gene ID 23399
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 735 bp
Gene Alias DULLARD,HSA011916,NET56
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGCGGACGCAGTGTCTGCTGGGGCTGCGCACGTTCGTGGCCTTCGCCGCCAAGCTCTGGAGCTTCTTCATTTACCTTCTGCGGAGGCAGATCCGCACGGTAATTCAGTACCAAACTGTTCGATATGATATCCTCCCCTTATCTCCTGTGTCCCGGAATCGGCTAGCCCAGGTGAAGAGGAAGATCCTGGTGCTGGATCTGGATGAGACACTTATTCACTCCCACCATGATGGGGTCCTGAGGCCCACAGTCCGGCCTGGTACGCCTCCTGACTTCATCCTCAAGGTGGTAATAGACAAACATCCTGTCCGGTTTTTTGTACATAAGAGGCCCCATGTGGATTTCTTCCTGGAAGTGGTGAGCCAGTGGTACGAGCTGGTGGTGTTTACAGCAAGCATGGAGATCTATGGCTCTGCTGTGGCAGATAAACTGGACAATAGCAGAAGCATTCTTAAGAGGAGATATTACAGACAGCACTGCACTTTGGAGTTGGGCAGCTACATCAAGGACCTCTCTGTGGTCCACAGTGACCTCTCCAGCATTGTGATCCTGGATAACTCCCCAGGGGCTTACAGGAGCCATCCAGACAATGCCATCCCCATCAAATCCTGGTTCAGTGACCCCAGCGACACAGCCCTTCTCAACCTGCTCCCAATGCTGGATGCCCTCAGGTTCACCGCTGATGTTCGTTCCGTGCTGAGCCGAAACCTTCACCAACATCGGCTCTGGTGA
ORF Protein Sequence MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0625-Ab Anti-CTDNEP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0625-Ag CTDNEP1 protein
    ORF Viral Vector pGMLP000911 Human CTDNEP1 Lentivirus plasmid
    ORF Viral Vector pGMAP000436 Human DULLARD Adenovirus plasmid
    ORF Viral Vector vGMLP000911 Human CTDNEP1 Lentivirus particle
    ORF Viral Vector vGMAP000436 Human DULLARD Adenovirus particle


    Target information

    Target ID GM-IP0625
    Target Name CTDNEP1
    Gene ID 23399, 67181, 721795, 287447, 101094889, 607484, 509192, 100072951
    Gene Symbol and Synonyms 2610507E10Rik,CTDNEP1,DULLARD,HSA011916,NET56
    Uniprot Accession O95476
    Uniprot Entry Name CNEP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000175826
    Target Classification Not Available

    Enables protein serine/threonine phosphatase activity. Involved in several processes, including positive regulation of triglyceride biosynthetic process; protein dephosphorylation; and protein localization to nucleus. Located in endoplasmic reticulum membrane; lipid droplet; and nuclear membrane. Part of Nem1-Spo7 phosphatase complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.