Human CBX7 ORF/cDNA clone-Lentivirus plasmid (NM_175709.4)

Cat. No.: pGMLP000913
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CBX7/ Lentiviral expression plasmid for CBX7 lentivirus packaging, CBX7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CBX7/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $489
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000913
Gene Name CBX7
Accession Number NM_175709.4
Gene ID 23492
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 756 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCTGTCAGCCATCGGCGAGCAGGTGTTCGCCGTGGAGAGCATCCGGAAGAAGCGCGTGCGGAAGGGTAAAGTCGAGTATCTGGTGAAGTGGAAAGGATGGCCCCCAAAGTACAGCACGTGGGAGCCAGAAGAGCACATCTTGGACCCCCGCCTCGTCATGGCCTACGAGGAGAAGGAGGAGAGAGACCGAGCATCGGGGTATAGGAAGAGAGGTCCGAAACCCAAGCGGCTTCTGCTGCAGCGGCTGTACAGCATGGACCTGCGGAGCTCCCACAAGGCCAAGGGCAAGGAGAAGCTCTGCTTCTCCCTGACGTGCCCACTCGGCAGCGGGAGCCCTGAGGGGGTGGTCAAGGCGGGGGCACCTGAGCTGGTGGACAAGGGCCCCTTGGTGCCCACCCTGCCCTTCCCGCTCCGCAAGCCCCGAAAGGCCCACAAGTACCTGCGGCTCTCGCGCAAGAAGTTCCCGCCCCGCGGGCCCAACCTGGAGAGCCACAGCCATCGACGGGAGCTCTTCCTGCAGGAGCCACCGGCCCCAGACGTCCTGCAGGCGGCTGGCGAGTGGGAGCCTGCTGCGCAGCCCCCTGAAGAGGAGGCAGATGCCGACCTGGCCGAGGGGCCCCCTCCCTGGACACCTGCGCTCCCCTCAAGTGAGGTGACCGTGACCGACATCACCGCCAACTCCATCACCGTCACCTTCCGCGAGGCCCAGGCAGCTGAGGGCTTCTTCCGAGACCGCAGTGGGAAGTTCTGA
ORF Protein Sequence MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72319-Ab Anti-CBX7 monoclonal antibody
    Target Antigen GM-Tg-g-T72319-Ag CBX7 protein
    ORF Viral Vector pGMLP000913 Human CBX7 Lentivirus plasmid
    ORF Viral Vector vGMLP000913 Human CBX7 Lentivirus particle


    Target information

    Target ID GM-T72319
    Target Name CBX7
    Gene ID 23492, 52609, 703056, 362962, 101082836, 481247, 525770, 100070273
    Gene Symbol and Synonyms 1600014J01Rik,CBX7,D15Ertd417e
    Uniprot Accession O95931
    Uniprot Entry Name CBX7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000100307
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.