Human CBX7 ORF/cDNA clone-Lentivirus plasmid (NM_175709.4)
Cat. No.: pGMLP000913
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CBX7/ Lentiviral expression plasmid for CBX7 lentivirus packaging, CBX7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CBX7/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000913 |
Gene Name | CBX7 |
Accession Number | NM_175709.4 |
Gene ID | 23492 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 756 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGCTGTCAGCCATCGGCGAGCAGGTGTTCGCCGTGGAGAGCATCCGGAAGAAGCGCGTGCGGAAGGGTAAAGTCGAGTATCTGGTGAAGTGGAAAGGATGGCCCCCAAAGTACAGCACGTGGGAGCCAGAAGAGCACATCTTGGACCCCCGCCTCGTCATGGCCTACGAGGAGAAGGAGGAGAGAGACCGAGCATCGGGGTATAGGAAGAGAGGTCCGAAACCCAAGCGGCTTCTGCTGCAGCGGCTGTACAGCATGGACCTGCGGAGCTCCCACAAGGCCAAGGGCAAGGAGAAGCTCTGCTTCTCCCTGACGTGCCCACTCGGCAGCGGGAGCCCTGAGGGGGTGGTCAAGGCGGGGGCACCTGAGCTGGTGGACAAGGGCCCCTTGGTGCCCACCCTGCCCTTCCCGCTCCGCAAGCCCCGAAAGGCCCACAAGTACCTGCGGCTCTCGCGCAAGAAGTTCCCGCCCCGCGGGCCCAACCTGGAGAGCCACAGCCATCGACGGGAGCTCTTCCTGCAGGAGCCACCGGCCCCAGACGTCCTGCAGGCGGCTGGCGAGTGGGAGCCTGCTGCGCAGCCCCCTGAAGAGGAGGCAGATGCCGACCTGGCCGAGGGGCCCCCTCCCTGGACACCTGCGCTCCCCTCAAGTGAGGTGACCGTGACCGACATCACCGCCAACTCCATCACCGTCACCTTCCGCGAGGCCCAGGCAGCTGAGGGCTTCTTCCGAGACCGCAGTGGGAAGTTCTGA |
ORF Protein Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T72319-Ab | Anti-CBX7 monoclonal antibody |
Target Antigen | GM-Tg-g-T72319-Ag | CBX7 protein |
ORF Viral Vector | pGMLP000913 | Human CBX7 Lentivirus plasmid |
ORF Viral Vector | vGMLP000913 | Human CBX7 Lentivirus particle |
Target information
Target ID | GM-T72319 |
Target Name | CBX7 |
Gene ID | 23492, 52609, 703056, 362962, 101082836, 481247, 525770, 100070273 |
Gene Symbol and Synonyms | 1600014J01Rik,CBX7,D15Ertd417e |
Uniprot Accession | O95931 |
Uniprot Entry Name | CBX7_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000100307 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.