Human NPFF/FMRFAL ORF/cDNA clone-Lentivirus plasmid (NM_003717)

Cat. No.: pGMLP000930
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NPFF/FMRFAL Lentiviral expression plasmid for NPFF lentivirus packaging, NPFF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NPFF/FMRFAL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000930
Gene Name NPFF
Accession Number NM_003717
Gene ID 8620
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 342 bp
Gene Alias FMRFAL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATTCTAGGCAGGCTGCTGCACTGCTGGTGCTGCTGCTGTTAATAGACGGGGGCTGTGCTGAAGGGCCAGGAGGCCAGCAGGAAGACCAGCTCTCCGCGGAGGAAGACAGCGAACCCCTCCCACCACAGGATGCCCAGACCTCTGGGTCACTGTTGCACTACCTGCTCCAGGCAATGGAGAGACCTGGCCGGAGCCAAGCCTTCCTGTTTCAGCCCCAGAGGTTTGGCAGAAATACCCAGGGATCCTGGAGGAATGAATGGCTGAGTCCCCGGGCTGGAGAGGGGCTGAATTCCCAGTTCTGGAGCCTGGCTGCCCCTCAACGCTTTGGGAAGAAGTGA
ORF Protein Sequence MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1134-Ab Anti-NPFF/ FMRFAL functional antibody
    Target Antigen GM-Tg-g-SE1134-Ag NPFF protein
    ORF Viral Vector pGMLP000930 Human NPFF Lentivirus plasmid
    ORF Viral Vector vGMLP000930 Human NPFF Lentivirus particle


    Target information

    Target ID GM-SE1134
    Target Name NPFF
    Gene ID 8620, 54615, 703412, 60337, 281354, 100064068
    Gene Symbol and Synonyms FMRFAL,NPFF
    Uniprot Accession O15130
    Uniprot Entry Name NPFF_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000139574
    Target Classification Not Available

    This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.