Human RNASE7/RAE1 ORF/cDNA clone-Lentivirus plasmid (NM_032572)

Cat. No.: pGMLP000957
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNASE7/RAE1 Lentiviral expression plasmid for RNASE7 lentivirus packaging, RNASE7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RNASE7/RAE1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000957
Gene Name RNASE7
Accession Number NM_032572
Gene ID 84659
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 471 bp
Gene Alias RAE1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCACCGGCCAGAGCAGGATTCTGCCCCCTTCTGCTGCTTCTGCTGCTGGGGCTGTGGGTGGCAGAGATCCCAGTCAGTGCCAAGCCCAAGGGCATGACCTCATCACAGTGGTTTAAAATTCAGCACATGCAGCCCAGCCCTCAAGCATGCAACTCAGCCATGAAAAACATTAACAAGCACACAAAACGGTGCAAAGACCTCAACACCTTCCTGCACGAGCCTTTCTCCAGTGTGGCCGCCACCTGCCAGACCCCCAAAATAGCCTGCAAGAATGGCGATAAAAACTGCCACCAGAGCCACGGGGCCGTGTCCCTGACCATGTGTAAGCTCACCTCAGGGAAGCATCCGAACTGCAGGTACAAAGAGAAGCGACAGAACAAGTCTTACGTAGTGGCCTGTAAGCCTCCCCAGAAAAAGGACTCTCAGCAATTCCACCTGGTTCCTGTACACTTGGACAGAGTCCTTTAG
ORF Protein Sequence MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0450-Ab Anti-RNAS7/ RNASE7/ RAE1 functional antibody
    Target Antigen GM-Tg-g-SE0450-Ag RNASE7 protein
    ORF Viral Vector pGMLP000957 Human RNASE7 Lentivirus plasmid
    ORF Viral Vector vGMLP000957 Human RNASE7 Lentivirus particle


    Target information

    Target ID GM-SE0450
    Target Name RNASE7
    Gene ID 84659, 705600, 101092691
    Gene Symbol and Synonyms RAE1,RNASE7,RNASE8
    Uniprot Accession Q9H1E1
    Uniprot Entry Name RNAS7_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165799
    Target Classification Not Available

    The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.