Human PAQR3/RKTG ORF/cDNA clone-Lentivirus plasmid (NM_001040202)

Cat. No.: pGMLP000976
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAQR3/RKTG Lentiviral expression plasmid for PAQR3 lentivirus packaging, PAQR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PAQR3/RKTG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $534
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000976
Gene Name PAQR3
Accession Number NM_001040202
Gene ID 152559
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 936 bp
Gene Alias RKTG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCAGAAGCTGCTGAAGAGCGCGCATTACATCGAGCTGGGCAGCTACCAGTACTGGCCGGTCCTGGTGCCCCGTGGCATCCGCCTGTACACCTACGAGCAGATCCCCGGGTCCCTCAAGGACAACCCGTACATCACCGACGGCTACCGGGCCTACCTGCCGTCCAGGCTGTGTATCAAAAGTTTGTTTATTTTATCTAATGAGACAGTAAACATCTGGAGTCATTTGCTGGGTTTCTTTCTCTTCTTCACCCTGGGAATATATGACATGACATCTGTGTTACCTTCAGCAAGTGCGTCCAGAGAAGATTTTGTAATTTGTTCTATTTGTCTTTTCTGCTTCCAGGTCTGTATGCTTTGCTCTGTGGGCTATCATCTTTTTTCCTGCCATCGGTCAGAAAAAACATGTCGAAGATGGATGGCATTAGATTATGCAGGAATTTCTATTGGAATACTGGGCTGCTATGTCTCAGGAGTATTTTACGCATTTTATTGTAATAACTACTGGCGTCAGGTGTACTTGATCACAGTGCTTGCTATGATCCTGGCAGTGTTCTTTGCGCAGATTCATCCCAATTACCTCACGCAGCAATGGCAAAGGCTCCGTTCTATCATCTTTTGTTCTGTTTCGGGATATGGAGTGATTCCTACTCTTCACTGGGTTTGGCTCAATGGAGGAATTGGTGCTCCTATTGTACAGGACTTTGCACCCCGTGTAATTGTGATGTATATGATTGCTCTTCTTGCTTTCCTATTCTACATTTCCAAAGTCCCAGAGCGGTACTTTCCAGGACAACTAAACTACCTCGGATCAAGCCACCAAATATGGCATATCCTTGCAGTAGTGATGTTATATTGGTGGCATCAGTCAACAGTGTATGTCATGCAGTACAGACATAGCAAGCCTTGTCCTGACTATGTTTCACATTTGTGA
ORF Protein Sequence MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1323-Ab Anti-PAQR3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1323-Ag PAQR3 protein
    ORF Viral Vector pGMLP000976 Human PAQR3 Lentivirus plasmid
    ORF Viral Vector vGMLP000976 Human PAQR3 Lentivirus particle


    Target information

    Target ID GM-IP1323
    Target Name PAQR3
    Gene ID 152559, 231474, 697120, 305203, 101092936, 487820, 534876, 100059505
    Gene Symbol and Synonyms 6330415A20Rik,PAQR3,RKTG
    Uniprot Accession Q6TCH7
    Uniprot Entry Name PAQR3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163291
    Target Classification Not Available

    This gene encodes a seven-transmembrane protein localized in the Golgi apparatus in mammalian cells. The encoded protein belongs to the progestin and adipoQ receptor (PAQR) family. This protein functions as a tumor suppressor by inhibiting the Raf/MEK/ERK signaling cascade. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.