Human TMBIM6/BAXI1/BI-1 ORF/cDNA clone-Lentivirus plasmid (NM_003217.2)

Cat. No.: pGMLP000977
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMBIM6/BAXI1/BI-1 Lentiviral expression plasmid for TMBIM6 lentivirus packaging, TMBIM6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMBIM6/BAXI1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $478.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000977
Gene Name TMBIM6
Accession Number NM_003217.2
Gene ID 7009
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 714 bp
Gene Alias BAXI1,BI-1,TEGT
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACATATTTGATCGAAAGATCAACTTTGATGCGCTTTTAAAATTTTCTCATATAACCCCGTCAACGCAGCAGCACCTGAAGAAGGTCTATGCAAGTTTTGCCCTTTGTATGTTTGTGGCGGCTGCAGGGGCCTATGTCCATATGGTCACTCATTTCATTCAGGCTGGCCTGCTGTCTGCCTTGGGCTCCCTGATATTGATGATTTGGCTGATGGCAACACCTCATAGCCATGAAACTGAACAGAAAAGACTGGGACTTCTTGCTGGATTTGCATTCCTTACAGGAGTTGGCCTGGGCCCTGCCCTGGAGTTTTGTATTGCTGTCAACCCCAGCATCCTTCCCACTGCTTTCATGGGCACGGCAATGATCTTTACCTGCTTCACCCTCAGTGCACTCTATGCCAGGCGCCGTAGCTACCTCTTTCTGGGAGGTATCTTGATGTCAGCCCTGAGCTTGTTGCTTTTGTCTTCCCTGGGGAATGTTTTCTTTGGATCCATTTGGCTTTTCCAGGCAAACCTGTATGTGGGACTGGTGGTCATGTGTGGCTTCGTCCTTTTTGATACTCAACTCATTATTGAAAAGGCCGAACATGGAGATCAAGATTATATCTGGCACTGCATTGATCTCTTCTTAGATTTCATTACTGTCTTCAGAAAACTCATGATGATCCTGGCCATGAATGAAAAGGATAAGAAGAAAGAGAAGAAATGA
ORF Protein Sequence MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0229-Ab Anti-TMBIM6 monoclonal antibody
    Target Antigen GM-Tg-g-IP0229-Ag TMBIM6 protein
    ORF Viral Vector pGMLP000977 Human TMBIM6 Lentivirus plasmid
    ORF Viral Vector vGMLP000977 Human TMBIM6 Lentivirus particle


    Target information

    Target ID GM-IP0229
    Target Name TMBIM6
    Gene ID 7009, 110213, 677702, 24822, 101084551, 477614, 616210, 100052024
    Gene Symbol and Synonyms 5031406P05Rik,Ab1-011,Ac1-149,BAXI1,BI-1,Bi1,Cc1-27,TEGT,TMBIM6
    Uniprot Accession P55061
    Uniprot Entry Name BI1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000139644
    Target Classification Not Available

    Enables endoribonuclease inhibitor activity and ubiquitin protein ligase binding activity. Involved in several processes, including negative regulation of RNA metabolic process; negative regulation of intrinsic apoptotic signaling pathway; and response to L-glutamate. Acts upstream of or within negative regulation of calcium ion transport into cytosol. Located in endoplasmic reticulum membrane and mitochondrial membrane. Biomarker of cervical squamous cell carcinoma and prostate carcinoma. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.