Human PEX2/PAF1/PBD5A ORF/cDNA clone-Lentivirus plasmid (NM_001079867)

Cat. No.: pGMLP000983
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PEX2/PAF1/PBD5A Lentiviral expression plasmid for PEX2 lentivirus packaging, PEX2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PEX2/PAF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $529.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000983
Gene Name PEX2
Accession Number NM_001079867
Gene ID 5828
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 918 bp
Gene Alias PAF1,PBD5A,PBD5B,PMP3,PMP35,PXMP3,RNF72,ZWS3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCAGAAAAGAGAATGCGAAGAGTGCAAACAGAGTGCTAAGAATAAGCCAGTTGGATGCACTTGAACTAAACAAGGCCCTGGAGCAGCTAGTTTGGTCCCAGTTTACTCAGTGCTTTCATGGATTTAAACCTGGGCTGTTAGCTCGCTTTGAGCCAGAGGTGAAAGCGTGCTTATGGGTTTTCTTGTGGAGATTCACCATCTACTCCAAAAATGCCACAGTGGGACAGTCAGTTTTGAATATTAAGTACAAAAATGATTTTTCCCCTAACCTGAGATATCAGCCACCCAGTAAAAATCAAAAAATCTGGTATGCTGTTTGTACAATTGGTGGCAGGTGGTTAGAAGAACGATGCTATGATTTGTTTCGAAACCATCATTTAGCATCATTTGGGAAAGTCAAGCAGTGTGTGAATTTTGTGATTGGACTTTTGAAATTAGGTGGGCTGATTAATTTTTTGATTTTCCTTCAGAGGGGAAAGTTTGCAACTTTGACAGAACGTCTCCTAGGTATTCATTCTGTATTTTGCAAGCCTCAAAACATATGTGAAGTTGGCTTTGAATACATGAATAGGGAACTTCTCTGGCATGGTTTTGCTGAATTTCTGATTTTTCTCTTACCACTTATCAATGTCCAGAAGTTGAAAGCCAAGCTGTCTTCATGGTGTATTCCTCTTACTGGTGCACCTAATAGTGACAATACATTAGCCACCAGTGGCAAAGAATGCGCTCTATGTGGAGAGTGGCCCACCATGCCTCACACCATAGGATGTGAGCATATTTTCTGTTATTTCTGTGCTAAGAGTAGTTTCTTATTTGACGTGTACTTTACTTGTCCTAAGTGTGGCACAGAAGTACACAGTCTGCAGCCACTGAAATCAGGAATCGAGATGTCAGAAGTAAATGCTCTTTAG
ORF Protein Sequence MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNICEVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1372-Ab Anti-PEX2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1372-Ag PEX2 protein
    ORF Viral Vector pGMLP000983 Human PEX2 Lentivirus plasmid
    ORF Viral Vector pGMLP001828 Human PEX2 Lentivirus plasmid
    ORF Viral Vector vGMLP000983 Human PEX2 Lentivirus particle
    ORF Viral Vector vGMLP001828 Human PEX2 Lentivirus particle


    Target information

    Target ID GM-IP1372
    Target Name PEX2
    Gene ID 5828, 19302, 701636, 29534, 101083568, 487007, 512677, 100059654
    Gene Symbol and Synonyms D3Ertd138e,PAF-1,PAF1,PBD5A,PBD5B,Peroxin-2,PEX2,PMP3,PMP35,PXMP3,RNF72,ZWS3
    Uniprot Accession P28328
    Uniprot Entry Name PEX2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164751
    Target Classification Not Available

    This gene encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.