Human HCRT/NRCLP1/OX ORF/cDNA clone-Lentivirus plasmid (NM_001524)

Cat. No.: pGMLP001015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HCRT/NRCLP1/OX Lentiviral expression plasmid for HCRT lentivirus packaging, HCRT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HCRT/NRCLP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001015
Gene Name HCRT
Accession Number NM_001524
Gene ID 3060
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 396 bp
Gene Alias NRCLP1,OX,PPOX
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCTTCCTTCCACAAAGGTCTCCTGGGCCGCCGTGACGCTACTGCTGCTGCTGCTGCTGCTGCCGCCCGCGCTGTTGTCGTCCGGGGCGGCTGCACAGCCCCTGCCCGACTGCTGTCGTCAAAAGACTTGCTCTTGCCGCCTCTACGAGCTGCTGCACGGCGCGGGCAATCACGCGGCCGGCATCCTCACGCTGGGCAAGCGGAGGTCCGGGCCCCCGGGCCTCCAGGGTCGGCTGCAGCGCCTCCTGCAGGCCAGCGGCAACCACGCCGCGGGCATCCTGACCATGGGCCGCCGCGCAGGCGCAGAGCCAGCGCCGCGCCCCTGCCTCGGGCGCCGCTGTTCCGCCCCGGCCGCCGCCTCCGTCGCGCCCGGAGGACAGTCCGGGATCTGA
ORF Protein Sequence MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T60744-Ab Anti-OREX/ HCRT/ NRCLP1 functional antibody
    Target Antigen GM-Tg-g-T60744-Ag HCRT protein
    ORF Viral Vector pGMLP001015 Human HCRT Lentivirus plasmid
    ORF Viral Vector vGMLP001015 Human HCRT Lentivirus particle


    Target information

    Target ID GM-T60744
    Target Name HCRT
    Gene ID 3060, 15171, 709564, 25723, 111557774, 607641, 281222, 100066236
    Gene Symbol and Synonyms HCRT,NRCLP1,orexin-A,OX,PPOX
    Uniprot Accession O43612
    Uniprot Entry Name OREX_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000161610
    Target Classification Not Available

    This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis. [provided by RefSeq, Jan 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.