Human ADM/AM/PAMP ORF/cDNA clone-Lentivirus plasmid (NM_001124)

Cat. No.: pGMLP001161
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ADM/AM/PAMP Lentiviral expression plasmid for ADM lentivirus packaging, ADM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ADM/AM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $439.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001161
Gene Name ADM
Accession Number NM_001124
Gene ID 133
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 558 bp
Gene Alias AM,PAMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTGGTTTCCGTCGCCCTGATGTACCTGGGTTCGCTCGCCTTCCTAGGCGCTGACACCGCTCGGTTGGATGTCGCGTCGGAGTTTCGAAAGAAGTGGAATAAGTGGGCTCTGAGTCGTGGGAAGAGGGAACTGCGGATGTCCAGCAGCTACCCCACCGGGCTCGCTGACGTGAAGGCCGGGCCTGCCCAGACCCTTATTCGGCCCCAGGACATGAAGGGTGCCTCTCGAAGCCCCGAAGACAGCAGTCCGGATGCCGCCCGCATCCGAGTCAAGCGCTACCGCCAGAGCATGAACAACTTCCAGGGCCTCCGGAGCTTTGGCTGCCGCTTCGGGACGTGCACGGTGCAGAAGCTGGCACACCAGATCTACCAGTTCACAGATAAGGACAAGGACAACGTCGCCCCCAGGAGCAAGATCAGCCCCCAGGGCTACGGCCGCCGGCGCCGGCGCTCCCTGCCCGAGGCCGGCCCGGGTCGGACTCTGGTGTCTTCTAAGCCACAAGCACACGGGGCTCCAGCCCCCCCGAGTGGAAGTGCTCCCCACTTTCTTTAG
ORF Protein Sequence MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-183 Pre-Made Enibarcimab biosimilar, Whole mAb, Anti-ADM Antibody: Anti-AM/PAMP therapeutic antibody
    Target Antibody GM-Tg-g-T20629-Ab Anti-ADML/ ADM/ AM functional antibody
    Target Antigen GM-Tg-g-T20629-Ag ADM protein
    ORF Viral Vector pGMLP001161 Human ADM Lentivirus plasmid
    ORF Viral Vector vGMLP001161 Human ADM Lentivirus particle


    Target information

    Target ID GM-T20629
    Target Name ADM
    Gene ID 133, 11535, 703305, 25026, 101087095, 403817, 280713, 100033857
    Gene Symbol and Synonyms ADM,AM,AMPP,Ap,H39316,PAMP,RATAP
    Uniprot Accession P35318
    Uniprot Entry Name ADML_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Acute tubulo-interstitial nephritis, lung cancer
    Gene Ensembl ENSG00000148926
    Target Classification Not Available

    The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.