Human ADM/AM/PAMP ORF/cDNA clone-Lentivirus plasmid (NM_001124)
Cat. No.: pGMLP001161
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ADM/AM/PAMP Lentiviral expression plasmid for ADM lentivirus packaging, ADM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
ADM/AM products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001161 |
Gene Name | ADM |
Accession Number | NM_001124 |
Gene ID | 133 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 558 bp |
Gene Alias | AM,PAMP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGCTGGTTTCCGTCGCCCTGATGTACCTGGGTTCGCTCGCCTTCCTAGGCGCTGACACCGCTCGGTTGGATGTCGCGTCGGAGTTTCGAAAGAAGTGGAATAAGTGGGCTCTGAGTCGTGGGAAGAGGGAACTGCGGATGTCCAGCAGCTACCCCACCGGGCTCGCTGACGTGAAGGCCGGGCCTGCCCAGACCCTTATTCGGCCCCAGGACATGAAGGGTGCCTCTCGAAGCCCCGAAGACAGCAGTCCGGATGCCGCCCGCATCCGAGTCAAGCGCTACCGCCAGAGCATGAACAACTTCCAGGGCCTCCGGAGCTTTGGCTGCCGCTTCGGGACGTGCACGGTGCAGAAGCTGGCACACCAGATCTACCAGTTCACAGATAAGGACAAGGACAACGTCGCCCCCAGGAGCAAGATCAGCCCCCAGGGCTACGGCCGCCGGCGCCGGCGCTCCCTGCCCGAGGCCGGCCCGGGTCGGACTCTGGTGTCTTCTAAGCCACAAGCACACGGGGCTCCAGCCCCCCCGAGTGGAAGTGCTCCCCACTTTCTTTAG |
ORF Protein Sequence | MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-183 | Pre-Made Enibarcimab biosimilar, Whole mAb, Anti-ADM Antibody: Anti-AM/PAMP therapeutic antibody |
Target Antibody | GM-Tg-g-T20629-Ab | Anti-ADML/ ADM/ AM functional antibody |
Target Antigen | GM-Tg-g-T20629-Ag | ADM protein |
ORF Viral Vector | pGMLP001161 | Human ADM Lentivirus plasmid |
ORF Viral Vector | vGMLP001161 | Human ADM Lentivirus particle |
Target information
Target ID | GM-T20629 |
Target Name | ADM |
Gene ID | 133, 11535, 703305, 25026, 101087095, 403817, 280713, 100033857 |
Gene Symbol and Synonyms | ADM,AM,AMPP,Ap,H39316,PAMP,RATAP |
Uniprot Accession | P35318 |
Uniprot Entry Name | ADML_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index |
Disease | Acute tubulo-interstitial nephritis, lung cancer |
Gene Ensembl | ENSG00000148926 |
Target Classification | Not Available |
The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.