Human KMT5A/PR-Set7/SET07 ORF/cDNA clone-Lentivirus plasmid (NM_001324504.1)

Cat. No.: pGMLP001217
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KMT5A/PR-Set7/SET07 Lentiviral expression plasmid for KMT5A lentivirus packaging, KMT5A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to KMT5A/PR-Set7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $542.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001217
Gene Name KMT5A
Accession Number NM_001324504.1
Gene ID 387893
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 969 bp
Gene Alias PR-Set7,SET07,SET8,SETD8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTAGAGGCAGGAAGATGTCCAAGCCCCGCACCGACGGGGAGAACGTATTTACCGGGCAGTCAAAGATCTATTCCTACATGAGCCCGAACAAATGCTCTGGAATGCGTTTCCCCCTTCAGGAAGAGAACTCAGTTACACATCACGAAGTCAAATGCCAGGGGAAACCATTAGCCGGAATCTACAGGAAACGAGAAGAGAAAAGAAATGCTGGGAACGCAGTACGGAGCGCCATGAAGTCCGAGGAACAGAAGATCAAAGACGCCAGGAAAGGTCCCCTGGTACCTTTTCCAAACCAAAAATCTGAAGCAGCAGAACCTCCAAAAACTCCACCCTCATCTTGTGATTCCACCAATGCAGCCATCGCCAAGCAAGCCCTGAAAAAGCCCATCAAGGGCAAACAGGCCCCCCGAAAAAAAGCTCAAGGAAAAACGCAACAGAATCGCAAACTTACGGATTTCTACCCTGTCCGAAGGAGCTCCAGGAAGAGCAAAGCCGAGCTGCAGTCTGAAGAAAGGAAAAGAATAGATGAATTGATTGAAAGTGGGAAGGAAGAAGGAATGAAGATTGACCTCATCGATGGCAAAGGCAGGGGTGTGATTGCCACCAAGCAGTTCTCCCGGGGTGACTTTGTGGTGGAATACCACGGGGACCTCATCGAGATCACCGACGCCAAGAAACGGGAGGCTCTGTACGCACAGGACCCTTCCACGGGCTGCTACATGTACTATTTTCAGTATCTGAGCAAAACCTACTGCGTGGATGCAACTAGAGAGACAAATCGCCTAGGAAGACTGATCAATCACAGCAAATGTGGGAACTGCCAAACCAAACTGCACGACATCGACGGCGTACCTCACCTCATCCTCATCGCCTCCCGAGACATCGCGGCTGGGGAGGAGCTCCTGTATGACTATGGGGACCGCAGCAAGGCTTCCATTGAAGCCCACCCGTGGCTGAAGCATTAA
ORF Protein Sequence MARGRKMSKPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T30420-Ab Anti-KMT5A monoclonal antibody
    Target Antigen GM-Tg-g-T30420-Ag KMT5A protein
    ORF Viral Vector pGMLP001217 Human KMT5A Lentivirus plasmid
    ORF Viral Vector pGMLV000866 Human KMT5A Lentivirus plasmid
    ORF Viral Vector pGMLV002511 Human KMT5A Lentivirus plasmid
    ORF Viral Vector vGMLP001217 Human KMT5A Lentivirus particle
    ORF Viral Vector vGMLV000866 Human KMT5A Lentivirus particle
    ORF Viral Vector vGMLV002511 Human KMT5A Lentivirus particle


    Target information

    Target ID GM-T30420
    Target Name KMT5A
    Gene ID 387893, 67956, 709345, 689820, 101086008, 610615, 532622, 100060853
    Gene Symbol and Synonyms 2410195B05Rik,KMT5A,PR-Set7,PR/SET07,RGD1305893,SET07,SET8,SETD8
    Uniprot Accession Q9NQR1
    Uniprot Entry Name KMT5A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000183955
    Target Classification Not Available

    The protein encoded by this gene is a protein-lysine N-methyltransferase that can monomethylate Lys-20 of histone H4 to effect transcriptional repression of some genes. The encoded protein is required for cell proliferation and plays a role in chromatin condensation. [provided by RefSeq, May 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.