Human RNF144B/bA528A10.3/IBRDC2 ORF/cDNA clone-Lentivirus plasmid (NM_182757)

Cat. No.: pGMLP001221
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNF144B/bA528A10.3/IBRDC2 Lentiviral expression plasmid for RNF144B lentivirus packaging, RNF144B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RNF144B/bA528A10.3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $528
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001221
Gene Name RNF144B
Accession Number NM_182757
Gene ID 255488
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 912 bp
Gene Alias bA528A10.3,IBRDC2,p53RFP,PIR2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTCAGCTGGTAGGCTCCACTATCTCGCCATGACTGCTGAAAATCCCACTCCTGGAGACCTGGCTCCGGCCCCCCTCATCACTTGCAAACTCTGCCTGTGTGAGCAGTCTCTGGACAAGATGACCACACTCCAGGAATGCCAGTGCATCTTTTGCACAGCTTGCCTGAAACAGTACATGCAGCTGGCAATCCGAGAAGGATGTGGGTCTCCCATCACTTGCCCTGACATGGTGTGCCTAAACCACGGGACCCTGCAGGAAGCTGAGATTGCCTGTTTGGTACCTGTGGACCAGTTTCAACTTTATCAGAGGTTAAAATTTGAAAGAGAAGTTCATCTGGACCCCTACCGAACATGGTGTCCTGTTGCAGACTGTCAGACAGTGTGCCCTGTTGCCTCGAGTGACCCAGGACAGCCTGTGCTGGTGGAATGCCCTTCTTGCCACCTGAAATTCTGCTCGTGTTGCAAGGATGCTTGGCATGCAGAGGTCTCCTGTAGAGACAGTCAGCCTATTGTCCTGCCAACAGAGCACCGAGCCCTCTTTGGGACAGATGCAGAAGCCCCCATTAAGCAGTGCCCAGTTTGCCGGGTTTATATCGAACGCAATGAAGGCTGCGCTCAGATGATGTGCAAAAACTGCAAGCATACATTTTGCTGGTACTGCCTCCAGAACTTGGATAATGACATTTTCCTCAGACATTATGACAAAGGGCCATGCAGGAATAAACTTGGCCACTCAAGAGCATCAGTGATGTGGAACCGAACACAGGTGGTGGGGATTCTCGTAGGCTTGGGCATCATTGCCTTGGTTACTTCACCCTTGTTACTCCTGGCCTCCCCATGTATAATCTGTTGTGTCTGCAAGTCCTGTCGGGGCAAGAAGAAAAAGCACGACCCATCCACAACCTAA
ORF Protein Sequence MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1509-Ab Anti-RNF144B monoclonal antibody
    Target Antigen GM-Tg-g-IP1509-Ag RNF144B protein
    ORF Viral Vector pGMLP001221 Human RNF144B Lentivirus plasmid
    ORF Viral Vector pGMLV001759 Human RNF144B Lentivirus plasmid
    ORF Viral Vector pGMPC000774 Human RNF144B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001221 Human RNF144B Lentivirus particle
    ORF Viral Vector vGMLV001759 Human RNF144B Lentivirus particle


    Target information

    Target ID GM-IP1509
    Target Name RNF144B
    Gene ID 255488, 218215, 705099, 364681, 101099205, 488237, 524166, 100052124
    Gene Symbol and Synonyms bA528A10.3,E130105P19Rik,IBRDC2,p53RFP,PIR2,RNF144B
    Uniprot Accession Q7Z419
    Uniprot Entry Name R144B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000137393
    Target Classification Not Available

    Enables ubiquitin-protein transferase activity. Involved in negative regulation of apoptotic process and ubiquitin-dependent protein catabolic process. Located in mitochondrial membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.