Human YIPF6/FinGER6 ORF/cDNA clone-Lentivirus plasmid (NM_173834)

Cat. No.: pGMLP001246
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human YIPF6/FinGER6 Lentiviral expression plasmid for YIPF6 lentivirus packaging, YIPF6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to YIPF6/FinGER6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $477.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001246
Gene Name YIPF6
Accession Number NM_173834
Gene ID 286451
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 711 bp
Gene Alias FinGER6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAAGCGGAGGAGTCTCCAGGAGACCCGGGGACAGCATCGCCCAGGCCCCTGTTTGCAGGCCTTTCAGATATATCCATCTCACAAGACATCCCCGTAGAAGGAGAAATCACCATTCCTATGAGATCTCGCATCCGGGAGTTTGACAGCTCCACATTAAATGAATCTGTTCGCAATACCATCATGCGTGATCTAAAAGCTGTTGGGAAAAAATTCATGCATGTTTTGTACCCAAGGAAAAGTAATACTCTTTTGAGAGATTGGGATTTGTGGGGCCCTTTGATCCTTTGTGTGACACTCGCATTAATGCTGCAAAGAGACTCTGCAGATAGTGAAAAAGATGGAGGGCCCCAATTTGCAGAGGTGTTTGTCATTGTCTGGTTTGGTGCAGTTACCATCACCCTCAACTCAAAACTTCTTGGAGGGAACATATCTTTTTTTCAGAGCCTCTGTGTGCTGGGTTACTGTATACTTCCCTTGACAGTAGCAATGCTGATTTGCCGGCTGGTACTTTTGGCTGATCCAGGACCTGTAAACTTCATGGTTCGGCTTTTTGTGGTGATTGTGATGTTTGCCTGGTCTATAGTTGCCTCCACAGCTTTCCTTGCTGATAGCCAGCCTCCAAACCGCAGAGCCCTAGCTGTTTATCCTGTTTTCCTGTTTTACTTTGTCATCAGTTGGATGATTCTCACCTTTACTCCTCAGTAA
ORF Protein Sequence MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2290-Ab Anti-YIPF6 monoclonal antibody
    Target Antigen GM-Tg-g-IP2290-Ag YIPF6 protein
    ORF Viral Vector pGMLP001246 Human YIPF6 Lentivirus plasmid
    ORF Viral Vector vGMLP001246 Human YIPF6 Lentivirus particle


    Target information

    Target ID GM-IP2290
    Target Name YIPF6
    Gene ID 286451, 77929, 713477, 363476, 101082295, 491931, 540347, 100066275
    Gene Symbol and Synonyms A430107J06Rik,FinGER6,YIPF6
    Uniprot Accession Q96EC8
    Uniprot Entry Name YIPF6_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000181704
    Target Classification Not Available

    Predicted to enable identical protein binding activity. Predicted to act upstream of or within intestinal epithelial cell development. Located in Golgi apparatus subcompartment and endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.