Human TMEM159 ORF/cDNA clone-Lentivirus plasmid (NM_001301775)

Cat. No.: pGMLP001286
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM159/ Lentiviral expression plasmid for TMEM159 lentivirus packaging, TMEM159 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM159/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $439.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001286
Gene Name TMEM159
Accession Number NM_001301775
Gene ID 57146
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 558 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAAAAGAGGAGCCCCAGAGTATCTCAAGGGACTTGCAGGAACTGCAGAAGAAGCTGTCTCTGCTGATAGACTCCTTCCAGAATAACTCAAAGCTGCCCCAACACAGCAGGATCTCACTGGACTCTGATGATGGAGTGTCCAGGCTGGGCAGTGCTGGCTCCAAGGTGGTGGCCTTTATGAAGTCTCCAGTGGGTCAGTACTTGGACAGCCATCCGTTTCTGGCCTTCACCTTGCTGGTGTTCATTGTCATGTCGGCCGTTCCTGTTGGATTCTTCCTGCTCATCGTGGTGCTTACCACCCTGGCTGCTCTGCTGGGGGTCATAATATTGGAAGGATTGGTCATCTCTGTGGGTGGCTTCTCACTGCTCTGCATCCTCTGTGGTTTGGGCTTCGTATCACTCGCCATGTCGGGGATGATGATAGCATCTTATGTAGTGGTCTCCAGCCTCATCAGCTGCTGGTTTTCTCCCAGGCCACTGACACAGCAAAACACCAGTTGTGACTTTCTGCCAGCCATGAAGTCTGCAGAATTCGAGGGGCTTTACCAGGAATGA
ORF Protein Sequence MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKLPQHSRISLDSDDGVSRLGSAGSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSAEFEGLYQE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1999-Ab Anti-TMEM159 monoclonal antibody
    Target Antigen GM-Tg-g-IP1999-Ag TMEM159 protein
    ORF Viral Vector pGMLP001286 Human TMEM159 Lentivirus plasmid
    ORF Viral Vector vGMLP001286 Human TMEM159 Lentivirus particle


    Target information

    Target ID GM-IP1999
    Target Name TMEM159
    Gene ID 57146, 233806, 697344, 378467, 101081270, 479819, 784639, 100057992
    Gene Symbol and Synonyms 8430420C20Rik,LDAF1,promethin,TMEM159
    Uniprot Accession Q96B96
    Uniprot Entry Name LDAF1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000011638
    Target Classification Not Available

    Involved in lipid droplet formation. Located in endoplasmic reticulum membrane and lipid droplet. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.