Human PEX12/PAF-3/PBD3A ORF/cDNA clone-Lentivirus plasmid (NM_000286)
Cat. No.: pGMLP001545
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PEX12/PAF-3/PBD3A Lentiviral expression plasmid for PEX12 lentivirus packaging, PEX12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PEX12/PAF-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001545 |
Gene Name | PEX12 |
Accession Number | NM_000286 |
Gene ID | 5193 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1080 bp |
Gene Alias | PAF-3,PBD3A |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGAGCACGGGGCTCACTTCACAGCTGCTTCTGTGGCCGATGACCAGCCATCCATCTTTGAGGTGGTAGCACAGGACAGTTTAATGACAGCAGTGAGACCCGCTCTTCAGCATGTGGTCAAGGTTCTTGCAGAATCAAATCCCACCCACTATGGCTTCTTGTGGAGGTGGTTTGATGAAATCTTTACTCTGCTAGATCTTCTGCTCCAGCAACATTATCTGTCTAGAACCAGTGCCTCATTTTCTGAAAACTTTTACGGCTTAAAGAGAATTGTAATGGGGGACACTCACAAGTCTCAGAGATTGGCTAGTGCTGGTCTCCCAAAGCAGCAGCTTTGGAAATCTATTATGTTCCTGGTTCTTCTTCCCTATCTGAAAGTGAAGCTGGAGAAGCTGGTTTCTAGCCTGAGAGAAGAGGATGAATATTCTATTCATCCCCCTTCTTCCCGCTGGAAACGATTTTACAGAGCTTTCCTGGCAGCCTACCCATTTGTGAACATGGCCTGGGAAGGATGGTTTCTTGTACAACAACTTCGATACATCCTAGGAAAAGCTCAGCATCACTCACCACTGCTGAGGCTGGCTGGAGTTCAGCTAGGTCGACTGACAGTTCAGGATATACAAGCTCTGGAGCACAAACCAGCTAAGGCCAGCATGATGCAGCAACCAGCCAGGAGTGTTAGTGAGAAGATAAACTCAGCTCTGAAGAAAGCTGTTGGGGGTGTTGCCTTATCCCTGTCTACTGGCCTTTCTGTGGGTGTATTCTTCTTGCAGTTCCTTGACTGGTGGTACTCATCTGAAAATCAAGAAACCATCAAGTCATTGACTGCCCTGCCTACTCCACCACCACCTGTACACCTAGACTATAACTCTGATTCTCCCCTCTTACCCAAAATGAAGACTGTGTGCCCACTGTGTCGTAAAACCCGGGTGAATGATACTGTTCTTGCCACCTCTGGCTATGTGTTTTGTTACCGCTGTGTGTTTCATTATGTGAGGAGTCACCAAGCTTGTCCCATCACAGGTTATCCAACAGAAGTACAACATCTGATTAAACTCTACTCCCCTGAGAACTGA |
ORF Protein Sequence | MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1368-Ab | Anti-PEX12 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1368-Ag | PEX12 protein |
ORF Viral Vector | pGMLP001545 | Human PEX12 Lentivirus plasmid |
ORF Viral Vector | vGMLP001545 | Human PEX12 Lentivirus particle |
Target information
Target ID | GM-IP1368 |
Target Name | PEX12 |
Gene ID | 5193, 103737, 716045, 116718, 101099510, 491139, 506007, 100058090 |
Gene Symbol and Synonyms | PAF-3,PBD3A,Peroxin-12,PEX12 |
Uniprot Accession | O00623 |
Uniprot Entry Name | PEX12_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000108733 |
Target Classification | Not Available |
This gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS). [provided by RefSeq, Oct 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.