Human PEX12/PAF-3/PBD3A ORF/cDNA clone-Lentivirus plasmid (NM_000286)

Cat. No.: pGMLP001545
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PEX12/PAF-3/PBD3A Lentiviral expression plasmid for PEX12 lentivirus packaging, PEX12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PEX12/PAF-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $602.4
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001545
Gene Name PEX12
Accession Number NM_000286
Gene ID 5193
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1080 bp
Gene Alias PAF-3,PBD3A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGAGCACGGGGCTCACTTCACAGCTGCTTCTGTGGCCGATGACCAGCCATCCATCTTTGAGGTGGTAGCACAGGACAGTTTAATGACAGCAGTGAGACCCGCTCTTCAGCATGTGGTCAAGGTTCTTGCAGAATCAAATCCCACCCACTATGGCTTCTTGTGGAGGTGGTTTGATGAAATCTTTACTCTGCTAGATCTTCTGCTCCAGCAACATTATCTGTCTAGAACCAGTGCCTCATTTTCTGAAAACTTTTACGGCTTAAAGAGAATTGTAATGGGGGACACTCACAAGTCTCAGAGATTGGCTAGTGCTGGTCTCCCAAAGCAGCAGCTTTGGAAATCTATTATGTTCCTGGTTCTTCTTCCCTATCTGAAAGTGAAGCTGGAGAAGCTGGTTTCTAGCCTGAGAGAAGAGGATGAATATTCTATTCATCCCCCTTCTTCCCGCTGGAAACGATTTTACAGAGCTTTCCTGGCAGCCTACCCATTTGTGAACATGGCCTGGGAAGGATGGTTTCTTGTACAACAACTTCGATACATCCTAGGAAAAGCTCAGCATCACTCACCACTGCTGAGGCTGGCTGGAGTTCAGCTAGGTCGACTGACAGTTCAGGATATACAAGCTCTGGAGCACAAACCAGCTAAGGCCAGCATGATGCAGCAACCAGCCAGGAGTGTTAGTGAGAAGATAAACTCAGCTCTGAAGAAAGCTGTTGGGGGTGTTGCCTTATCCCTGTCTACTGGCCTTTCTGTGGGTGTATTCTTCTTGCAGTTCCTTGACTGGTGGTACTCATCTGAAAATCAAGAAACCATCAAGTCATTGACTGCCCTGCCTACTCCACCACCACCTGTACACCTAGACTATAACTCTGATTCTCCCCTCTTACCCAAAATGAAGACTGTGTGCCCACTGTGTCGTAAAACCCGGGTGAATGATACTGTTCTTGCCACCTCTGGCTATGTGTTTTGTTACCGCTGTGTGTTTCATTATGTGAGGAGTCACCAAGCTTGTCCCATCACAGGTTATCCAACAGAAGTACAACATCTGATTAAACTCTACTCCCCTGAGAACTGA
ORF Protein Sequence MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1368-Ab Anti-PEX12 monoclonal antibody
    Target Antigen GM-Tg-g-IP1368-Ag PEX12 protein
    ORF Viral Vector pGMLP001545 Human PEX12 Lentivirus plasmid
    ORF Viral Vector vGMLP001545 Human PEX12 Lentivirus particle


    Target information

    Target ID GM-IP1368
    Target Name PEX12
    Gene ID 5193, 103737, 716045, 116718, 101099510, 491139, 506007, 100058090
    Gene Symbol and Synonyms PAF-3,PBD3A,Peroxin-12,PEX12
    Uniprot Accession O00623
    Uniprot Entry Name PEX12_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000108733
    Target Classification Not Available

    This gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS). [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.