Human CCNE2/CYCE2 ORF/cDNA clone-Lentivirus plasmid (NM_057749)

Cat. No.: pGMLP001613
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCNE2/CYCE2 Lentiviral expression plasmid for CCNE2 lentivirus packaging, CCNE2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCNE2/CYCE2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $640.2
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001613
Gene Name CCNE2
Accession Number NM_057749
Gene ID 9134
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1215 bp
Gene Alias CYCE2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAAGACGAAGTAGCCGTTTACAAGCTAAGCAGCAGCCCCAGCCCAGCCAGACGGAATCCCCCCAAGAAGCCCAGATAATCCAGGCCAAGAAGAGGAAAACTACCCAGGATGTCAAAAAAAGAAGAGAGGAGGTCACCAAGAAACATCAGTATGAAATTAGGAATTGTTGGCCACCTGTATTATCTGGGGGGATCAGTCCTTGCATTATCATTGAAACACCTCACAAAGAAATAGGAACAAGTGATTTCTCCAGATTTACAAATTACAGATTTAAAAATCTTTTTATTAATCCTTCACCTTTGCCTGATTTAAGCTGGGGATGTTCAAAAGAAGTCTGGCTAAACATGTTAAAAAAGGAGAGCAGATATGTTCATGACAAACATTTTGAAGTTCTGCATTCTGACTTGGAACCACAGATGAGGTCCATACTTCTAGACTGGCTTTTAGAGGTATGTGAAGTATACACACTTCATAGGGAAACATTTTATCTTGCACAAGACTTTTTTGATAGATTTATGTTGACACAAAAGGATATAAATAAAAATATGCTTCAACTCATTGGAATTACCTCATTATTCATTGCTTCCAAACTTGAGGAAATCTATGCTCCTAAACTCCAAGAGTTTGCTTACGTCACTGATGGTGCTTGCAGTGAAGAGGATATCTTAAGGATGGAACTCATTATATTAAAGGCTTTAAAATGGGAACTTTGTCCTGTAACAATCATCTCCTGGCTAAATCTCTTTCTCCAAGTTGATGCTCTTAAAGATGCTCCTAAAGTTCTTCTACCTCAGTATTCTCAGGAAACATTCATTCAAATAGCTCAGCTTTTAGATCTGTGTATTCTAGCCATTGATTCATTAGAGTTCCAGTACAGAATACTGACTGCTGCTGCCTTGTGCCATTTTACCTCCATTGAAGTGGTTAAGAAAGCCTCAGGTTTGGAGTGGGACAGTATTTCAGAATGTGTAGATTGGATGGTACCTTTTGTCAATGTAGTAAAAAGTACTAGTCCAGTGAAGCTGAAGACTTTTAAGAAGATTCCTATGGAAGACAGACATAATATCCAGACACATACAAACTATTTGGCTATGCTGGAGGAAGTAAATTACATAAACACCTTCAGAAAAGGGGGACAGTTGTCACCAGTGTGCAATGGAGGCATTATGACACCACCGAAGAGCACTGAAAAACCACCAGGAAAACACTAA
ORF Protein Sequence MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T19027-Ab Anti-CCNE2 monoclonal antibody
    Target Antigen GM-Tg-g-T19027-Ag CCNE2 protein
    ORF Viral Vector pGMLP001613 Human CCNE2 Lentivirus plasmid
    ORF Viral Vector vGMLP001613 Human CCNE2 Lentivirus particle


    Target information

    Target ID GM-T19027
    Target Name CCNE2
    Gene ID 9134, 12448, 700382, 362485, 101085347, 487057, 538436, 100055302
    Gene Symbol and Synonyms CCNE2,CYCE2
    Uniprot Accession O96020
    Uniprot Entry Name CCNE2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Breast Cancer
    Gene Ensembl ENSG00000175305
    Target Classification Not Available

    The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.