Human CCNE2/CYCE2 ORF/cDNA clone-Lentivirus plasmid (NM_057749)
Cat. No.: pGMLP001613
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCNE2/CYCE2 Lentiviral expression plasmid for CCNE2 lentivirus packaging, CCNE2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CCNE2/CYCE2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001613 |
Gene Name | CCNE2 |
Accession Number | NM_057749 |
Gene ID | 9134 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1215 bp |
Gene Alias | CYCE2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCAAGACGAAGTAGCCGTTTACAAGCTAAGCAGCAGCCCCAGCCCAGCCAGACGGAATCCCCCCAAGAAGCCCAGATAATCCAGGCCAAGAAGAGGAAAACTACCCAGGATGTCAAAAAAAGAAGAGAGGAGGTCACCAAGAAACATCAGTATGAAATTAGGAATTGTTGGCCACCTGTATTATCTGGGGGGATCAGTCCTTGCATTATCATTGAAACACCTCACAAAGAAATAGGAACAAGTGATTTCTCCAGATTTACAAATTACAGATTTAAAAATCTTTTTATTAATCCTTCACCTTTGCCTGATTTAAGCTGGGGATGTTCAAAAGAAGTCTGGCTAAACATGTTAAAAAAGGAGAGCAGATATGTTCATGACAAACATTTTGAAGTTCTGCATTCTGACTTGGAACCACAGATGAGGTCCATACTTCTAGACTGGCTTTTAGAGGTATGTGAAGTATACACACTTCATAGGGAAACATTTTATCTTGCACAAGACTTTTTTGATAGATTTATGTTGACACAAAAGGATATAAATAAAAATATGCTTCAACTCATTGGAATTACCTCATTATTCATTGCTTCCAAACTTGAGGAAATCTATGCTCCTAAACTCCAAGAGTTTGCTTACGTCACTGATGGTGCTTGCAGTGAAGAGGATATCTTAAGGATGGAACTCATTATATTAAAGGCTTTAAAATGGGAACTTTGTCCTGTAACAATCATCTCCTGGCTAAATCTCTTTCTCCAAGTTGATGCTCTTAAAGATGCTCCTAAAGTTCTTCTACCTCAGTATTCTCAGGAAACATTCATTCAAATAGCTCAGCTTTTAGATCTGTGTATTCTAGCCATTGATTCATTAGAGTTCCAGTACAGAATACTGACTGCTGCTGCCTTGTGCCATTTTACCTCCATTGAAGTGGTTAAGAAAGCCTCAGGTTTGGAGTGGGACAGTATTTCAGAATGTGTAGATTGGATGGTACCTTTTGTCAATGTAGTAAAAAGTACTAGTCCAGTGAAGCTGAAGACTTTTAAGAAGATTCCTATGGAAGACAGACATAATATCCAGACACATACAAACTATTTGGCTATGCTGGAGGAAGTAAATTACATAAACACCTTCAGAAAAGGGGGACAGTTGTCACCAGTGTGCAATGGAGGCATTATGACACCACCGAAGAGCACTGAAAAACCACCAGGAAAACACTAA |
ORF Protein Sequence | MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T19027-Ab | Anti-CCNE2 monoclonal antibody |
Target Antigen | GM-Tg-g-T19027-Ag | CCNE2 protein |
ORF Viral Vector | pGMLP001613 | Human CCNE2 Lentivirus plasmid |
ORF Viral Vector | vGMLP001613 | Human CCNE2 Lentivirus particle |
Target information
Target ID | GM-T19027 |
Target Name | CCNE2 |
Gene ID | 9134, 12448, 700382, 362485, 101085347, 487057, 538436, 100055302 |
Gene Symbol and Synonyms | CCNE2,CYCE2 |
Uniprot Accession | O96020 |
Uniprot Entry Name | CCNE2_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000175305 |
Target Classification | Not Available |
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.